SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16804802|ref|NP_466287.1| from Listeria monocytogenes EGD-e

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16804802|ref|NP_466287.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.96e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16804802|ref|NP_466287.1|
Sequence length 102
Comment hypothetical protein lmo2765 [Listeria monocytogenes EGD-e]
Sequence
MNEMETVIFGMISQVGSARSSYLEGLRAAREGNFEEAEAKLKEGGETLANGHHEHHKLIQ
KEASGEKVEIQLLLIHAEDLLITTETLREVVTEFVHVYKKIN
Download sequence
Identical sequences A0A0E0UZX0 A0A0H3GFS3 A0A1D2IRJ6 A0A2G8Q189 A0A2G8Q498 A0A2G8QAK4 A0A2G8QRX2 A0A2G8QTL7 Q8Y3R8
gi|386054954|ref|YP_005972512.1| gi|386009546|ref|YP_005927824.1| gi|470211819|ref|YP_007608393.1| gi|284800348|ref|YP_003412213.1| gi|550898940|ref|YP_008668436.1| gi|386048500|ref|YP_005966832.1| 169963.lmo2765 552536.LMHCC_2758 gi|405759830|ref|YP_006689106.1| gi|386051747|ref|YP_005969738.1| gi|386045073|ref|YP_005963878.1| gi|386028171|ref|YP_005948947.1| gi|284993533|ref|YP_003415301.1| gi|217966029|ref|YP_002351707.1| NP_466287.1.42710 WP_003722125.1.100045 WP_003722125.1.100060 WP_003722125.1.100112 WP_003722125.1.100229 WP_003722125.1.100530 WP_003722125.1.100835 WP_003722125.1.10112 WP_003722125.1.101184 WP_003722125.1.101252 WP_003722125.1.101354 WP_003722125.1.101368 WP_003722125.1.101752 WP_003722125.1.10198 WP_003722125.1.10420 WP_003722125.1.10484 WP_003722125.1.1123 WP_003722125.1.11266 WP_003722125.1.11313 WP_003722125.1.11419 WP_003722125.1.11712 WP_003722125.1.11738 WP_003722125.1.11779 WP_003722125.1.11851 WP_003722125.1.11907 WP_003722125.1.11940 WP_003722125.1.11973 WP_003722125.1.11976 WP_003722125.1.12037 WP_003722125.1.12143 WP_003722125.1.12377 WP_003722125.1.12824 WP_003722125.1.13052 WP_003722125.1.13105 WP_003722125.1.13134 WP_003722125.1.13304 WP_003722125.1.1336 WP_003722125.1.13428 WP_003722125.1.13695 WP_003722125.1.137 WP_003722125.1.1556 WP_003722125.1.16207 WP_003722125.1.1657 WP_003722125.1.16634 WP_003722125.1.17352 WP_003722125.1.17375 WP_003722125.1.17604 WP_003722125.1.1764 WP_003722125.1.17644 WP_003722125.1.17695 WP_003722125.1.1794 WP_003722125.1.17947 WP_003722125.1.18979 WP_003722125.1.19080 WP_003722125.1.19189 WP_003722125.1.19371 WP_003722125.1.19409 WP_003722125.1.1947 WP_003722125.1.19548 WP_003722125.1.19626 WP_003722125.1.20416 WP_003722125.1.21046 WP_003722125.1.21133 WP_003722125.1.21884 WP_003722125.1.21995 WP_003722125.1.22154 WP_003722125.1.22190 WP_003722125.1.22202 WP_003722125.1.22383 WP_003722125.1.22434 WP_003722125.1.22656 WP_003722125.1.22962 WP_003722125.1.23193 WP_003722125.1.23254 WP_003722125.1.23419 WP_003722125.1.23582 WP_003722125.1.23624 WP_003722125.1.2422 WP_003722125.1.24370 WP_003722125.1.24546 WP_003722125.1.24651 WP_003722125.1.24836 WP_003722125.1.24945 WP_003722125.1.24972 WP_003722125.1.25401 WP_003722125.1.26052 WP_003722125.1.26060 WP_003722125.1.26103 WP_003722125.1.26138 WP_003722125.1.26145 WP_003722125.1.26146 WP_003722125.1.26166 WP_003722125.1.26320 WP_003722125.1.26350 WP_003722125.1.26406 WP_003722125.1.26523 WP_003722125.1.26632 WP_003722125.1.26891 WP_003722125.1.27200 WP_003722125.1.27839 WP_003722125.1.28042 WP_003722125.1.28062 WP_003722125.1.28123 WP_003722125.1.28297 WP_003722125.1.28325 WP_003722125.1.28402 WP_003722125.1.28747 WP_003722125.1.28803 WP_003722125.1.2920 WP_003722125.1.29331 WP_003722125.1.29550 WP_003722125.1.29705 WP_003722125.1.29723 WP_003722125.1.29738 WP_003722125.1.29762 WP_003722125.1.29872 WP_003722125.1.29912 WP_003722125.1.30227 WP_003722125.1.305 WP_003722125.1.30827 WP_003722125.1.30882 WP_003722125.1.30902 WP_003722125.1.31444 WP_003722125.1.31830 WP_003722125.1.32209 WP_003722125.1.32210 WP_003722125.1.32402 WP_003722125.1.32472 WP_003722125.1.32622 WP_003722125.1.33039 WP_003722125.1.3324 WP_003722125.1.33240 WP_003722125.1.337 WP_003722125.1.33875 WP_003722125.1.33995 WP_003722125.1.34326 WP_003722125.1.34732 WP_003722125.1.350 WP_003722125.1.35402 WP_003722125.1.35450 WP_003722125.1.36203 WP_003722125.1.36241 WP_003722125.1.364 WP_003722125.1.36582 WP_003722125.1.36877 WP_003722125.1.36936 WP_003722125.1.37278 WP_003722125.1.3782 WP_003722125.1.37882 WP_003722125.1.38025 WP_003722125.1.38150 WP_003722125.1.38224 WP_003722125.1.38281 WP_003722125.1.38471 WP_003722125.1.3853 WP_003722125.1.38733 WP_003722125.1.38792 WP_003722125.1.38800 WP_003722125.1.39115 WP_003722125.1.39220 WP_003722125.1.39262 WP_003722125.1.39351 WP_003722125.1.3959 WP_003722125.1.39630 WP_003722125.1.39887 WP_003722125.1.40124 WP_003722125.1.40263 WP_003722125.1.405 WP_003722125.1.40720 WP_003722125.1.40820 WP_003722125.1.40953 WP_003722125.1.40976 WP_003722125.1.41281 WP_003722125.1.42127 WP_003722125.1.42615 WP_003722125.1.42958 WP_003722125.1.43267 WP_003722125.1.43327 WP_003722125.1.43619 WP_003722125.1.44023 WP_003722125.1.44106 WP_003722125.1.44645 WP_003722125.1.4479 WP_003722125.1.44897 WP_003722125.1.44924 WP_003722125.1.45295 WP_003722125.1.45309 WP_003722125.1.45524 WP_003722125.1.45708 WP_003722125.1.45759 WP_003722125.1.45811 WP_003722125.1.45877 WP_003722125.1.45983 WP_003722125.1.4604 WP_003722125.1.46045 WP_003722125.1.4615 WP_003722125.1.46314 WP_003722125.1.46863 WP_003722125.1.46883 WP_003722125.1.47055 WP_003722125.1.47203 WP_003722125.1.47593 WP_003722125.1.4766 WP_003722125.1.47738 WP_003722125.1.47953 WP_003722125.1.48358 WP_003722125.1.48572 WP_003722125.1.48624 WP_003722125.1.48999 WP_003722125.1.49202 WP_003722125.1.49467 WP_003722125.1.49604 WP_003722125.1.49668 WP_003722125.1.49952 WP_003722125.1.49962 WP_003722125.1.50236 WP_003722125.1.50237 WP_003722125.1.50243 WP_003722125.1.50334 WP_003722125.1.50883 WP_003722125.1.50888 WP_003722125.1.50898 WP_003722125.1.50926 WP_003722125.1.50971 WP_003722125.1.5129 WP_003722125.1.51435 WP_003722125.1.51510 WP_003722125.1.51720 WP_003722125.1.51732 WP_003722125.1.5175 WP_003722125.1.52177 WP_003722125.1.52395 WP_003722125.1.52447 WP_003722125.1.52617 WP_003722125.1.52867 WP_003722125.1.52989 WP_003722125.1.53102 WP_003722125.1.53266 WP_003722125.1.53566 WP_003722125.1.53807 WP_003722125.1.53920 WP_003722125.1.54046 WP_003722125.1.54155 WP_003722125.1.54160 WP_003722125.1.54181 WP_003722125.1.54564 WP_003722125.1.5472 WP_003722125.1.54890 WP_003722125.1.55231 WP_003722125.1.55238 WP_003722125.1.55487 WP_003722125.1.55683 WP_003722125.1.55740 WP_003722125.1.55797 WP_003722125.1.55824 WP_003722125.1.55890 WP_003722125.1.56269 WP_003722125.1.56526 WP_003722125.1.56923 WP_003722125.1.57132 WP_003722125.1.57171 WP_003722125.1.57404 WP_003722125.1.57504 WP_003722125.1.57578 WP_003722125.1.57766 WP_003722125.1.57948 WP_003722125.1.57963 WP_003722125.1.57979 WP_003722125.1.58030 WP_003722125.1.58088 WP_003722125.1.58177 WP_003722125.1.58828 WP_003722125.1.59045 WP_003722125.1.59477 WP_003722125.1.59571 WP_003722125.1.5973 WP_003722125.1.59799 WP_003722125.1.59949 WP_003722125.1.59984 WP_003722125.1.60166 WP_003722125.1.60258 WP_003722125.1.60297 WP_003722125.1.60346 WP_003722125.1.60369 WP_003722125.1.60665 WP_003722125.1.60956 WP_003722125.1.61002 WP_003722125.1.61109 WP_003722125.1.61244 WP_003722125.1.62177 WP_003722125.1.62430 WP_003722125.1.62629 WP_003722125.1.62655 WP_003722125.1.62663 WP_003722125.1.62852 WP_003722125.1.62904 WP_003722125.1.62972 WP_003722125.1.63951 WP_003722125.1.6397 WP_003722125.1.64041 WP_003722125.1.64200 WP_003722125.1.64227 WP_003722125.1.6460 WP_003722125.1.648 WP_003722125.1.65213 WP_003722125.1.65309 WP_003722125.1.65376 WP_003722125.1.65730 WP_003722125.1.6579 WP_003722125.1.65827 WP_003722125.1.65913 WP_003722125.1.66005 WP_003722125.1.66039 WP_003722125.1.66184 WP_003722125.1.66311 WP_003722125.1.66338 WP_003722125.1.66512 WP_003722125.1.6672 WP_003722125.1.66884 WP_003722125.1.67301 WP_003722125.1.6731 WP_003722125.1.67352 WP_003722125.1.67408 WP_003722125.1.67610 WP_003722125.1.6763 WP_003722125.1.67668 WP_003722125.1.67709 WP_003722125.1.67795 WP_003722125.1.67884 WP_003722125.1.68112 WP_003722125.1.68321 WP_003722125.1.68528 WP_003722125.1.69265 WP_003722125.1.69471 WP_003722125.1.69579 WP_003722125.1.69727 WP_003722125.1.6982 WP_003722125.1.70309 WP_003722125.1.7031 WP_003722125.1.70588 WP_003722125.1.70992 WP_003722125.1.71468 WP_003722125.1.71921 WP_003722125.1.72051 WP_003722125.1.72057 WP_003722125.1.72116 WP_003722125.1.7218 WP_003722125.1.72385 WP_003722125.1.72467 WP_003722125.1.72636 WP_003722125.1.72841 WP_003722125.1.734 WP_003722125.1.73656 WP_003722125.1.74217 WP_003722125.1.74290 WP_003722125.1.74351 WP_003722125.1.74450 WP_003722125.1.7454 WP_003722125.1.74572 WP_003722125.1.74754 WP_003722125.1.74837 WP_003722125.1.7498 WP_003722125.1.75069 WP_003722125.1.75541 WP_003722125.1.75604 WP_003722125.1.75624 WP_003722125.1.76124 WP_003722125.1.76769 WP_003722125.1.77116 WP_003722125.1.77149 WP_003722125.1.77192 WP_003722125.1.77246 WP_003722125.1.77350 WP_003722125.1.7736 WP_003722125.1.77376 WP_003722125.1.77420 WP_003722125.1.77681 WP_003722125.1.77823 WP_003722125.1.78121 WP_003722125.1.78203 WP_003722125.1.7832 WP_003722125.1.78525 WP_003722125.1.79184 WP_003722125.1.7932 WP_003722125.1.79351 WP_003722125.1.79434 WP_003722125.1.79458 WP_003722125.1.79630 WP_003722125.1.79803 WP_003722125.1.79964 WP_003722125.1.80028 WP_003722125.1.80036 WP_003722125.1.80105 WP_003722125.1.80790 WP_003722125.1.81261 WP_003722125.1.81503 WP_003722125.1.81662 WP_003722125.1.81693 WP_003722125.1.81713 WP_003722125.1.81725 WP_003722125.1.81833 WP_003722125.1.82440 WP_003722125.1.82667 WP_003722125.1.82719 WP_003722125.1.82893 WP_003722125.1.82951 WP_003722125.1.83030 WP_003722125.1.83121 WP_003722125.1.83215 WP_003722125.1.83236 WP_003722125.1.83260 WP_003722125.1.83323 WP_003722125.1.83478 WP_003722125.1.83542 WP_003722125.1.83546 WP_003722125.1.83932 WP_003722125.1.8418 WP_003722125.1.84367 WP_003722125.1.84539 WP_003722125.1.84586 WP_003722125.1.84588 WP_003722125.1.8473 WP_003722125.1.84980 WP_003722125.1.85037 WP_003722125.1.85203 WP_003722125.1.8593 WP_003722125.1.86253 WP_003722125.1.86308 WP_003722125.1.86484 WP_003722125.1.86597 WP_003722125.1.866 WP_003722125.1.86958 WP_003722125.1.87085 WP_003722125.1.8710 WP_003722125.1.87108 WP_003722125.1.87536 WP_003722125.1.87701 WP_003722125.1.87794 WP_003722125.1.87920 WP_003722125.1.88015 WP_003722125.1.88112 WP_003722125.1.88128 WP_003722125.1.88485 WP_003722125.1.88584 WP_003722125.1.8884 WP_003722125.1.88890 WP_003722125.1.89085 WP_003722125.1.89127 WP_003722125.1.89160 WP_003722125.1.8932 WP_003722125.1.89386 WP_003722125.1.89450 WP_003722125.1.89478 WP_003722125.1.89809 WP_003722125.1.90135 WP_003722125.1.9019 WP_003722125.1.90201 WP_003722125.1.90567 WP_003722125.1.90821 WP_003722125.1.90829 WP_003722125.1.9109 WP_003722125.1.91168 WP_003722125.1.91514 WP_003722125.1.91556 WP_003722125.1.91765 WP_003722125.1.92049 WP_003722125.1.92132 WP_003722125.1.92142 WP_003722125.1.92148 WP_003722125.1.92274 WP_003722125.1.92409 WP_003722125.1.92548 WP_003722125.1.92595 WP_003722125.1.93777 WP_003722125.1.93859 WP_003722125.1.93895 WP_003722125.1.93997 WP_003722125.1.94058 WP_003722125.1.94191 WP_003722125.1.94758 WP_003722125.1.94961 WP_003722125.1.95186 WP_003722125.1.95256 WP_003722125.1.95715 WP_003722125.1.96033 WP_003722125.1.96140 WP_003722125.1.96296 WP_003722125.1.96407 WP_003722125.1.96586 WP_003722125.1.9672 WP_003722125.1.96874 WP_003722125.1.97165 WP_003722125.1.97203 WP_003722125.1.97315 WP_003722125.1.9732 WP_003722125.1.97390 WP_003722125.1.97820 WP_003722125.1.98038 WP_003722125.1.98042 WP_003722125.1.98060 WP_003722125.1.98193 WP_003722125.1.98331 WP_003722125.1.98351 WP_003722125.1.98375 WP_003722125.1.9894 WP_003722125.1.9916 WP_003722125.1.99357 WP_003722125.1.99409 WP_003722125.1.99480 WP_003722125.1.99512 WP_003722125.1.99520 WP_003722125.1.99527 WP_003722125.1.99786 WP_003722125.1.99914 gi|470208672|ref|YP_007605247.1| gi|16804802|ref|NP_466287.1| gi|404412017|ref|YP_006697605.1| gi|404285274|ref|YP_006686171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]