SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|506928593|ref|YP_008009031.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506928593|ref|YP_008009031.1|
Domain Number 1 Region: 96-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.84e-52
Family C-terminal domain of adrenodoxin reductase-like 0.0000374
Further Details:      
 
Domain Number 2 Region: 2-156
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.3e-16
Family N-terminal domain of adrenodoxin reductase-like 0.00032
Further Details:      
 
Domain Number 3 Region: 297-433
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000306
Family N-terminal domain of adrenodoxin reductase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506928593|ref|YP_008009031.1|
Sequence length 439
Comment ferredoxin--NADP+ reductase [Amycolatopsis orientalis HCCB10007]
Sequence
MGAGPAGIYAADILDKSDADVTIDLFERMPAPFGLIRYGVAPDHPRIKGIVTALHKVLDK
PNIRLLGNVDYGTDLKLDDLRQFYDAVIFSTGAMADRALDIPGIDLDGSYGAADFVSWYD
GHPDVPRTWPLNATSVAVLGVGNVALDVARILAKTADELLSTDIPDNVYQGLKASPVTDV
HVFGRRGPAQAKFTPLELRELDHSPNVEVIVYPEDIEFDEGSIAALRASKQIDMVVKTLQ
EWAIRDQGDRPKRLHLHFLHSPCEIVGEDGKVTGLRTERTELTGDGNVRGTGEFHVWDVQ
AVYRAVGYLSSHLPEIPFDHTTGTVPNQAGRVLDIDEEQVPGVYVTGWIKRGPVGLIGHT
KGDAAETIASLLADAGNLTAPAVEDPDAILGFLTERGVPFTTWEGWGKLDAHEKALGVPH
GRERVKVVERDEMTRISRS
Download sequence
Identical sequences R4SVS3
gi|506928593|ref|YP_008009031.1| WP_016330495.1.6660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]