SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332157688|ref|YP_004422967.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332157688|ref|YP_004422967.1|
Domain Number 1 Region: 80-201,496-535
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.14e-36
Family Intein (protein splicing domain) 0.022
Further Details:      
 
Domain Number 2 Region: 535-773
Classification Level Classification E-value
Superfamily Radical SAM enzymes 4.32e-30
Family MoCo biosynthesis proteins 0.018
Further Details:      
 
Domain Number 3 Region: 372-470
Classification Level Classification E-value
Superfamily Homing endonucleases 1.19e-16
Family Intein endonuclease 0.018
Further Details:      
 
Domain Number 4 Region: 290-347
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000978
Family Intein endonuclease 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332157688|ref|YP_004422967.1|
Sequence length 966
Comment molybdenum cofactor biosynthesis MoaA [Pyrococcus sp. NA2]
Sequence
MWITKKCPEGMVTDLYYEDVELYYRFSRWKFEEKKLFSVNVENTGVNCPFDCGLCARHRS
HTSLLNIVLTNRCNLNCWYCFPPTEEAVFKFGDKVEIATFEEVARNFKFEHKVEIDGFKG
EYSIPNNLYVLTFNDGKAEWTRVTKFLRRKHEGKIRVIKTKTGRTIRTTPEHKFFVYKDG
ELIKKRADELEPGDELVLLWRFEPEETLTEINLLEAFKDLPQEEKEKIYVRGIKDLDLTL
LKEKYGDKVYHWIRQDSIPLNVFYELNVDLEKEFRLGRDATSYELPSKLKITPSLAKLIG
YFVSDGNYSDKDLRITTGHEDVEREIVSILEELGLPYSYLEWEGKTKQIVIGSRLLRLVF
KHVFKIPEGASNKRLPEGFLSFPFEAKVALLSGLFNGDGYVVRGERHLSIGYASVSRGLI
RDMIYLLASLGIFARVYRVPKEKMKGANHDLYKLYISGTDLVKLVELLELREGHREKLGE
VGNRKPARIKKIADFYIDIVDEISEEEYSGYVYDLEVENDSHSFVAADGILVSNCFFYAR
EGEPIYEPTLEQIRMMLRNAKKQHPIGANAVQFTGGEPTLRDDLVEIIKIAKEEGYDHIQ
LNTDGIRLAFEPELVKKIREAGVNTLYLSYDGMTPQTNWKNHWEIPLIFENVRKAGGPGI
VLVPTLIRNVNDHEAGAIINFGLNHLDIVRGVNFQPISLVGRVPKKERQRFRITIAGAIK
KIEDQTNGIISRDDWYPIPIAGHIARFFEVFTGKKYYMTSHFACGAATYVFLDREEKKVI
PIPRFLDVEGFVEFLLEKAEEIEKARFKGLAKLKAIGETVFIKFKQFYDEKHAPKGLDVL
SLIKNAFVHGNYDALGKFHLNTLFLGMMHFMDEYNYDVERVERCVIHYAMPDGRIVPFCT
FNVIPEIYRDKVQRQFSYSWEEWKKLHPDWDYKKDKYFRSKEFVEKMKRSELYRKTYIDI
INYFEV
Download sequence
Identical sequences F4HNI7
gi|332157688|ref|YP_004422967.1| WP_013747522.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]