SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332157734|ref|YP_004423013.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332157734|ref|YP_004423013.1|
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily GlnB-like 1.56e-33
Family DUF190/COG1993 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332157734|ref|YP_004423013.1|
Sequence length 127
Comment hypothetical protein PNA2_0091 [Pyrococcus sp. NA2]
Sequence
MVEVEHWNTLRLKIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKKSRIHS
SDVIRLSTDLPIVIEVVDRGHNIERAVNAIRPMIKDGMITVEPTIVLWMGAEEEIKKFEE
DAVAERR
Download sequence
Identical sequences F4HI82
WP_013747567.1.68068 gi|332157734|ref|YP_004423013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]