SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332157886|ref|YP_004423165.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332157886|ref|YP_004423165.1|
Domain Number 1 Region: 193-359
Classification Level Classification E-value
Superfamily RibA-like 7.98e-60
Family RibA-like 0.00000236
Further Details:      
 
Domain Number 2 Region: 5-185
Classification Level Classification E-value
Superfamily YrdC/RibB 2.52e-48
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332157886|ref|YP_004423165.1|
Sequence length 397
Comment riboflavin biosynthesis protein RibA [Pyrococcus sp. NA2]
Sequence
MDANALRKAILNGRPIVLVDERREKEADLVYPAELATSEVVNFMLEAKGMLCLAMDEEEA
LKRGFFRLPSKNSETNFLISVDYKDTKTGISADERALTARKIAEGLGIEHFRYPGHLHVL
GGIGLNRRKGHTEASLELMELLGFKRYALIIEILDRMGSSHNLEFVREFAEDHELPIVTI
RDVWKETVKRKSFLKIYAKAKLPSKYGDFEVISFENELDFKDHLVLIKRPMGNVPLVRVH
SECLTGDVFSSLRCDCGGQLENSLKLIGQEGGVLIYLRQEGRGIGLKDKIRAYALQEEGY
DTVEANRILGFNDDERDFSVAYQILKALGISKVRLLTNNPRKVEALKELGIDVVETIRIF
GDLTEHNKSYLLTKMMKLGHELEELLGGGCDDLRGRV
Download sequence
Identical sequences F4HJ41
WP_013747719.1.68068 gi|332157886|ref|YP_004423165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]