SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332158284|ref|YP_004423563.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332158284|ref|YP_004423563.1|
Domain Number 1 Region: 529-634,812-828,1022-1086
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.53e-29
Family Intein (protein splicing domain) 0.0094
Further Details:      
 
Domain Number 2 Region: 10-104,481-532
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-26
Family Extended AAA-ATPase domain 0.0000263
Further Details:      
 
Domain Number 3 Region: 84-200,428-467
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.66e-23
Family Intein (protein splicing domain) 0.074
Further Details:      
 
Domain Number 4 Region: 1175-1264
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 7.48e-23
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00000429
Further Details:      
 
Domain Number 5 Region: 1087-1157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000282
Family Extended AAA-ATPase domain 0.000037
Further Details:      
 
Domain Number 6 Region: 887-995
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000181
Family Intein endonuclease 0.047
Further Details:      
 
Weak hits

Sequence:  gi|332158284|ref|YP_004423563.1|
Domain Number - Region: 692-762
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000172
Family Transcription factor MotA, activation domain 0.063
Further Details:      
 
Domain Number - Region: 287-348
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000383
Family Group I mobile intron endonuclease 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332158284|ref|YP_004423563.1|
Sequence length 1267
Comment putative replication factor C small subunit [Pyrococcus sp. NA2]
Sequence
MEEVREVKVLEKPWVEKYRPQRLDEIVGQEHIVKRLKHYVKTGSMPHLLFAGPPGVGKTT
AALALARELFGENWRHNFLELNASVSKNTPILVRINERIVRTTFAELDRLYFDESDGDVA
YKDAPNLEVLTVDENYRVRWARVSKIIRHRVPVILRVHLEGGGKLELTGNHSVIVLTENG
LETVKASELSEGSVLLSFTANLEGLLDVLDIDTYRIRESASEALPVSEEPSHMLAHIINT
IGSHEEKFAERLSINLYGNYTYSSFDQIRFPNTQLAISFEENSYDRTRIPSFVFELPVHE
RIAFLRGLADELEGVIRIPSMSKDLLIDTVWLARISGIEGNLFEREARLIWKDRMKWSRA
DLLPAEPIVKMLKTIEHAIGGNQLYKGKKFIRKETLKRVIQMIDETRLDSKGRKILETLR
KLANSDLHALVVKKVELVEYNDFVYDVSVPGNEMFFAGEIPVLLHNSDERGINVIREKVK
EFARTKPIGGASFKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILSCVTGDTRIYTPD
EREIRIRDFIEYFENGLINEVRNRIGRDKVIATVAFNSRTVGHPVYRLTLESGRIIEATG
DHMFLTPEGWKQTYDIKEGSEVLVKPTLEGTPYEHDPRPIIDVKELYDFLDVVEREHGLK
PLGEAKTFRKLLTRDKERILKRALELRAEMEKGLTRKEAEILALIGEEWTTKEEIQEKAK
ISIVRLNQILMNLVSKGYVEKKGRGRKQLIRKLREGKAVKKITDIRRVLEEEFNMKITYM
TAKKLLSGEIDGLAYRIIKEVKEKWLLRYDDEKAGILARVIGFILGSGRISKRDIRIKSR
KENIEMLKEDLRRLGLEPIETTENTIHINNIAFHSLLRFWGVDRDVVPEWIRRGNLFVKR
EFLRGLFGAKGSGPIEEGHTIGDIKLEMSASRESFRRIRGLINDVEEMLREFGIESDVMI
TSVANRFIIRLIITPTYVNYLRFLTRIGYAYARDTLARLVAEYLRIKLYAETAVEMATAT
GTAKMIEVKKIKSAPMTFKEFVKERIFNGYIVEKVIKKEELGHLDVYDITCATDHSFISN
GLISHNCNYSSKIIEPIQSRCAIFRFRPLNDEDIAKRLKFIAEQEGLELTEEGLQAILYI
AEGDMRRAINILQAAAALDRKITDENVFMVASRARPEDIREMMLLALKGNFLKAREKLRE
ILLKQGLSGEDVLVQMHREVFNLPIEEPKKVYLADKIGEYNFRLVEGANELIQLEALLAQ
FTLIGKK
Download sequence
Identical sequences F4HLD2
gi|332158284|ref|YP_004423563.1| WP_013748113.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]