SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332158477|ref|YP_004423756.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332158477|ref|YP_004423756.1|
Domain Number 1 Region: 668-871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-64
Family RecA protein-like (ATPase-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 879-985
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 3.14e-27
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0037
Further Details:      
 
Domain Number 3 Region: 240-404,603-669
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.06e-26
Family Intein (protein splicing domain) 0.0074
Further Details:      
 
Domain Number 4 Region: 474-557
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000442
Family Intein endonuclease 0.014
Further Details:      
 
Domain Number 5 Region: 150-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000414
Family RecA protein-like (ATPase-domain) 0.012
Further Details:      
 
Domain Number 6 Region: 5-71
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.000000000000497
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|332158477|ref|YP_004423756.1|
Domain Number - Region: 97-178
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0188
Family Biotinyl/lipoyl-carrier proteins and domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332158477|ref|YP_004423756.1|
Sequence length 1017
Comment V-type ATP synthase subunit A [Pyrococcus sp. NA2]
Sequence
MPVKGEIIRVTGPLVVAKGMKGAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVR
PGEPVIGTGSSLSVELGPGLLTSIYDGIQRPLEVIREKTGDFITRGVTAPALPRDKKWHF
IPKVKVGDKVVGGDIIGEVPETSIIVHKIMVPPGIEGEIVEIAEEGDYTIEEVIAKVKTP
SGEIKELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAAIPGPFGSGK
CVDGDTLVLTKEFGLIKIRDLYKILDGKGKKTINGNEEWTELDNPITLYGYKNGKIVEIK
ATHIYKGFSAGMIEIKTRTGRKIRVTPIHKLFTGRVTKNGLEIKEVMAMDLKKGDRIIVA
KKIDGGERVKLNIKVDQKRGKKIKIPEVLDEKLAEFLGYLIADGTLKPRTVAIYNNDESI
LKRANELAKDLFNVEGKIIKEKTVKALLIHSKALVEFFSMLGVPRSKKARTWKVPKELLI
SEPEVVKAFIKAYIMCDGHYHEKKGEIEIVTASEEAAYGLSYLLAKLGIYAIIREKVIKD
RTYYRVIISGKSNLEKLGIARMGRGYTSFDVVPMDVEELYDAIGRSYAELKKAGIEIHNY
LSGENMSYEMFKRFAKFVGMEEIAENHLSHVLFDEIVEIRYIEMGQEVYDVTTETHNFVG
GNMPTLLHNTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERT
VLIANTSNMPVAAREASIYTGITIAEYFRDMGYDVALMADSTSRWAEALREISGRLEEMP
GEEGYPAYLASKLAEFYERAGRVITLGSDNRVGSVSVIGAVSPPGGDFSEPVVQNTLRVV
KVFWALDADLARRRHFPAINWLTSYSLYTDAVKDWWHKNVDPEWKKMRDEAMALLQKEAE
LQEIVRIVGPDALPERERAILLVARMLREDYLQQDAFDEVDTYCPPEKQVTMMRVLLNFY
HKTMEAINRGIPLEEIAKLPVREEIGRMKFERDIEKIRELIDKTNEQFEELFKKYGA
Download sequence
Identical sequences F4HM98
gi|332158477|ref|YP_004423756.1| WP_013748306.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]