SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332158568|ref|YP_004423847.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332158568|ref|YP_004423847.1|
Domain Number 1 Region: 151-266
Classification Level Classification E-value
Superfamily Homing endonucleases 7.02e-16
Family Group I mobile intron endonuclease 0.024
Further Details:      
 
Domain Number 2 Region: 67-147
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000665
Family Group I mobile intron endonuclease 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332158568|ref|YP_004423847.1|
Sequence length 272
Comment hypothetical protein PNA2_0927 [Pyrococcus sp. NA2]
Sequence
MRKISELSLDEAEHIKKRIPELRDEGLSYSKIVEIIKEEFHVSISKATVIRWCKGTSDLG
NRIKRVNLEPSPQLAYIIGVYFGDGSIDSDERYRYRVRLKVVDKEFAEAFANALKDIGAN
PRIYFEGSTGRWCAEATSKELYMFLSKPKEELLRIAEMFPREFIRGFFDSEGYVFVDPKD
PRMAYISVWNYDRELLEICRRLLLNNFNIHSTIFLKREKNSEVIIRGKVCKYNGDLYELR
IYRRESVKAFGERIGLTIDRKWRALKSFLLSY
Download sequence
Identical sequences F4HMI9
gi|332158568|ref|YP_004423847.1| WP_013748397.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]