SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332158632|ref|YP_004423911.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332158632|ref|YP_004423911.1|
Domain Number 1 Region: 755-898,1261-1473,1506-1581
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.83e-126
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00054
Further Details:      
 
Domain Number 2 Region: 897-1054,1194-1259
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.44e-40
Family Intein (protein splicing domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 324-463,696-760
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-34
Family Intein (protein splicing domain) 0.024
Further Details:      
 
Domain Number 4 Region: 1123-1210
Classification Level Classification E-value
Superfamily Homing endonucleases 5.57e-20
Family Intein endonuclease 0.05
Further Details:      
 
Domain Number 5 Region: 545-632
Classification Level Classification E-value
Superfamily Homing endonucleases 4.25e-16
Family Intein endonuclease 0.046
Further Details:      
 
Domain Number 6 Region: 270-323
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.0000000000000855
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0051
Further Details:      
 
Domain Number 7 Region: 9-160,238-267
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000000000000288
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0059
Further Details:      
 
Domain Number 8 Region: 448-536
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000357
Family Intein endonuclease 0.082
Further Details:      
 
Weak hits

Sequence:  gi|332158632|ref|YP_004423911.1|
Domain Number - Region: 1048-1119
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000312
Family Group I mobile intron endonuclease 0.055
Further Details:      
 
Domain Number - Region: 161-233
Classification Level Classification E-value
Superfamily EF-hand 0.1
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332158632|ref|YP_004423911.1|
Sequence length 1703
Comment ribonucleotide-diphosphate reductase subunit alpha [Pyrococcus sp. NA2]
Sequence
MPVEKVMKRDGRIVPFDESRIRWAVQRAMWEVGVRDERKLDEVVKNIVKRINELYDGKIP
HIENIQDIVELELMRAGLFEVAKAYILYRKKKAEIREEKKRILNKKELDEIDKRFSVNAL
RVLASRYLKRDENGNIIESPRELFERVAILAVIPDLLYDERVFDKEGNYKQDLKRVEYYL
ENFEKFDGKYSIGKYKLNKYHFERMVNLYRELAEKGKMKVSIDEFLSMLERGEFDKYEKE
IDEYFRLMTNQVFMPNTPALINSGRPLGMLSACFVVPIEDDMESIMKAAHDVAMIQKMGG
GTGINFSKLRPEGDLVGTTTGAACFTGDTRVLTERGFIPIEELVKTNQSPRIISHEGPKK
IVEKYDNGEMEVFRVVTEDGYEVKVTKEHKFLVFDENGNPILKPLMELKEGDYIYVLTPD
DFDAPYLELNTNVELKSKGYEVTLPKLLDERLAYLLGIIYADGHIRHYYENGRRKNSKIE
IYLNIDEKDVKEKVKKYFIELFGIEPKEFVREEQHKVTLVIPSTKIVKFLELNGLSKDKS
ENIAVPELIFRSRPSVIAAFLAGFFDGDGSIDQHYRIVLKSISERFIKEAQLLFLALGIV
TSIQEYEPKEDTHRKVYTLRVQTRDMKIKAFERLVESVKLATIREKALMDLEENGKNKKY
SFPFNAIYKIKRPEVRAKIQRDYKLISYNSKVTHRAFIRRILELKDELGLDEEEIKYFSM
LSKLYPVRISKIELLGVQKVYDIQVEGVHLLTGNGIYTSNSGPVSFMHLIDAVSDVIKQG
GVRRGANMGILEIWHPDIEKFIHAKEKNIGTNVLSNFNISVGIWEDFWEALKEGKKYPLI
NPRTGEVVKEVDPKTLFEELAYMAWAKADPGVIFFDVINRRNVLKKAKGGPIRATNPCVV
GDTRILTPEGYLKAEEIFSLAKERGKKEAVTVEGIAEEGEPYAYSVEILLPGEEKVEYET
AHGKVLAVADPVAVPAYVWKVGRKKVARVKTKEGYEITATLDHKLMTPEGWKEVGELKEG
DKILLPRFEVEEEFGSESIGEDLAFVLGWFIGDGYLNVNDKRAWFYFNAEKEEEIAVRIR
DILVKHFGIKAELHRYGSQIKLGVRGEAYRWLENIVKNNEKRIPEIVYRLKPREIAAFLR
GLFSADGYVDKDMAIRLTSKSRELLREVQDLLLLFGILSKIYEVEGHYELVITNYSRKLF
AEKIGLEGYKMEKLSLKKTKVDQPIVTVESVEVLGEEIVYDFTVPNHHMYISNGFMSHNC
GEEPLYEYESCNLASINLAKFVKYDENGKPYFDWDEYAYVIQKVAKYLDNSIDVNKFPLP
EIDYNTKLTRRIGVGMMGLADALFKLGIPYNSEEGFKFMRKVTEYLTFYAYKYSVEAAKK
RGTFPLYDKTEYPEGKLPVEGFYHPEIWNLPWDKLVEEIKKYGLRNAMVTTCPPTGSVSM
IADTSSGIEPVYALVYKKSVTVGEFYYVDPVFEEELKKRGLYSEELLKKISDNYGSVQGL
EEIPEDMQRVFVTALDIHWLDHIIAQASIQMWLTDSASKTINMPNDATVEDVKAAYLIAR
FLGCKGVTVYRDGSLSVQVYSVEGEKKKRRFKPKPSEYAKKILLEIVEKEPWIKNFINVD
EILNGKKEQPLFSLRPVKESEPKVSSKTNDMRPKDIPEEKIKELLGEVYCPVCYEREGKL
VELKMESGCATCPVCGWSKCVIS
Download sequence
Identical sequences F4HMQ3
gi|332158632|ref|YP_004423911.1| WP_013748461.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]