SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332159154|ref|YP_004424433.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332159154|ref|YP_004424433.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily GlnB-like 4.82e-36
Family Divalent ion tolerance proteins CutA (CutA1) 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332159154|ref|YP_004424433.1|
Sequence length 102
Comment periplasmic divalent cation tolerance protein CutA [Pyrococcus sp. NA2]
Sequence
MIIVYTTFPDWDSAEKVTKKLLEERLIACANLREHKAFYWWQGKIEEDREIGAIFKTREE
LWEEVKERIKELHPYTVPAIIRIDVKDVNEDYLKWLIEETKK
Download sequence
Identical sequences F4HJD3
WP_013748979.1.68068 gi|332159154|ref|YP_004424433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]