SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332159428|ref|YP_004424707.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332159428|ref|YP_004424707.1|
Domain Number 1 Region: 257-401
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.55e-18
Family MJ1460-like 0.0059
Further Details:      
 
Domain Number 2 Region: 11-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.98e-17
Family RecA protein-like (ATPase-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332159428|ref|YP_004424707.1|
Sequence length 405
Comment hypothetical protein PNA2_1789 [Pyrococcus sp. NA2]
Sequence
MYMSRTIRILMKLRTGIPTLDAILEGGFEKECNIALVGGIDNDYILLAHQLISSFLSQGS
RVLLVELRQDPSSLVRWLKQYGINYEGYIKEGQLKILDGFTNLYSPSSVSGPDILPNPLD
LGITTAIIRDNVSREMYDIVVFDDVTSLYALQTDYRAYIRVIVRLINSIRKLGASSLVAV
NSDVLSIKDLSMVLMPFEYLIEVKENVIRIKRSFSFISVPGIPYVKTSKGIVPTGDVLKD
ANTLRESLTVENEGTIKLGMARVQIVSESSERSLIEYVYQFLGAEKGREFLYGWGRYELE
RVNVTPIKGSIKELKALLEDMFEVTKTTGGGNLRIVEITENTIVIEGKDLFPKFEKFPYP
VHIHYAGSMAKLLEKATGDKWIGDEVECESQSDERCVFVLKRIQE
Download sequence
Identical sequences F4HL22
gi|332159428|ref|YP_004424707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]