SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332159437|ref|YP_004424716.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332159437|ref|YP_004424716.1|
Domain Number 1 Region: 19-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.11e-43
Family Tandem AAA-ATPase domain 0.0006
Further Details:      
 
Domain Number 2 Region: 346-470,558-629
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.88e-29
Family Intein (protein splicing domain) 0.0091
Further Details:      
 
Domain Number 3 Region: 275-348,633-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-20
Family Tandem AAA-ATPase domain 0.0084
Further Details:      
 
Domain Number 4 Region: 498-572
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000018
Family Intein endonuclease 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332159437|ref|YP_004424716.1|
Sequence length 1162
Comment putative ATP-dependent helicase LHR [Pyrococcus sp. NA2]
Sequence
MERIRWAEREYKDEEIYAILDPIVREWFRRKFKSFTPPQRYAIVEIHKGENVLISSPTGS
GKTLSAFLAIISELISLGRRGKLEDKIYCVYVSPLRALNNDIRRNLEEPLNEIIELAREL
KEEIPEIRVSVRTSDTSSYEKSKMLKKPPHILITTPESLAIAINAPKFREKLRDVKWVIV
DEVHALAENKRGSHLTLTLERLRELCGRDFVRIGLSATIHPLEEVAKFVFGFDDKGNPRP
GLIVDVSFAKKTEIRVESVVEDLIYTPANVLSETLYRRLGELIRKHRTTLIFTNTRSGAE
RVAYHLKKMFPEWEDKIEAHHSSLSREVRLDVEEKLKRGELKAVVCVPGHSIVFTPIGIK
RIDELDNEDQVLGIKNAKGDFVKFGGVQKIEYNSKGVRIRTRLGFEVEATLEHKFLTMKN
GQLIWREARELKPGDYVGIIRKLPELEDETLSKKFTPELARLLGFYLANGSKQMNVYDKL
GKERPDLTSLKLEVLPLLSREHKIQFLSGYFDGNGYITKNEVGFILSDPKHIEVIRSILL
QFGIIPSISGNKLKIPGGESFKRFKEIIDPWRDDLKEVKILDIQGEELTKGDILFDKIEE
IEETFIGEAYGIIDSETGNYVVNYFISKNSSTSLELGIDIGTIDLVVLIGSPKSVNRALQ
RIGRAGHKLHEVSKGIILALDRDDLVEVTVLAHNARNRRLDRIKIPKNPLDVLVQHLLGM
ALERVWDVNEAYKVVRRAYPFRDLPFEDFMNVLKYLAGEYAGLEERKVYAKIWLENGKFG
RRGKMTRAIYYMNTGTIPDEAKIDVFTMDKRYIGTVEEEFAERLMPGDIFVLAGRTYEFV
KSKGNRIYVIPREGAKPTIPSWFSEMLPLSFDLALDIQRFRREVKAILNNKRAESFLMKK
YGIDRMTAKAILSYFREQAKYSIIPDDETILVEIVEDGMVVKYFFHTLIGRRANDALSRA
FAYLISRKKKCNVGMAITDNGFMLKVPRSKALTEAEILELFNIENLRDVLMKALENTELL
KRRFRHVANRGLLILRRYMGKKKSLSKQQMNAQTLLNFLKKNYPDFPLLKEVYREIMEDK
MDIENAELFLRWIKEGKIKVIVKRHPYPSPFAFNLEVVGASDVVLMEDRRELIKELHKKI
MELIKEGGVPSPTAPRSPFAGV
Download sequence
Identical sequences F4HL31
WP_013749262.1.68068 gi|332159437|ref|YP_004424716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]