SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332159450|ref|YP_004424729.1| from Pyrococcus sp. NA2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332159450|ref|YP_004424729.1|
Domain Number 1 Region: 413-681
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-44
Family G proteins 0.00000263
Further Details:      
 
Domain Number 2 Region: 20-169,352-412
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.12e-39
Family Intein (protein splicing domain) 0.0068
Further Details:      
 
Domain Number 3 Region: 727-853
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 8.76e-35
Family Initiation factor IF2/eIF5b, domain 3 0.0000258
Further Details:      
 
Domain Number 4 Region: 858-985
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-26
Family Elongation factors 0.0000977
Further Details:      
 
Domain Number 5 Region: 174-260
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000113
Family Intein endonuclease 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332159450|ref|YP_004424729.1|
Sequence length 990
Comment translation initiation factor IF-2 [Pyrococcus sp. NA2]
Sequence
MTKRIRQPIIAVLGHVDHGKCLLPDEKVVIPSIGIVTLRELFETADKTIERDEEKEIRAL
ESTITCVNVDGRVSLIKAPYVWKVRHRGEIIRIKLKNWHSISVTPEHPFLTTRGWKRADQ
LKPGDYVAVPRFIQGNEDENIFLSYVKVKKSEEEWKRHFYLLGKEGRDFDVNLLFISPRR
YVAEFMRGYFDERSEVGEEGISVEAGKLAEYLSLALLRFGILSLIDGEKLTIKGRRNLKE
FKDRIGFTKTEKMKKLEELISRVKESEKYPIFEEIRRLMLLFGFTRDELKINDAPSYEKL
MEVLERIKNGSPTLEKKLAILEGRLRDNHYMKILEEEGLLKNGKLTDLGTELLEVWRNRE
FDSKDVDYVKNIAENLVFLPVESVEREEYDGYVYDVTTETHNFIANGIVVHNTTLLDRIR
KTNVAAKEAGGITQHIGATEVPIDVVKKIAGPLIKLWKAEIKLPGLLFIDTPGHEAFTSL
RARGGSLADLAVLVVDINEGFQPQTIESIEILRRYRTPFVVAANKIDRIRGWVIQEDEPF
LMNIKRQDQRAIQELETKLWELIGKFYEHGFQANRFDRVQNFTRELAIVPISAKYGIGIA
ELLVLIAGLSQKYLEEKLKIEVEGPARGTILEVREEPGLGHTIDVIIYDGTLRKDDTIVV
GGKDKAIVTKIRALLKPKPLDEIRDPRFRFDHVDEVTAAAGVKIAAPGLEEALAGSPVIV
ANTPEEVERAKEEIMEQIQSVVISTDKAGVIVKADTLGSLEALSKELQEKGIPIRKADIG
NVSKTDVMEALSVRDEDVKYGVILGFNVKVNEDAEEVAKAKGVPIFVGNVIYKLIEDYEA
WVKEEEEKKKRELLSKVTFPGVIRLYPDERYVFRRSNPAIVGIEVLEGRIRPGVTLIKQN
GQKVGVIKSIKSRDEFLQEARKGQAVAIAIEGAIVGRHIHPGEILYVDISRDDAITLLRN
LRDVLEDTDVKALKMTAQVKAKEDPFWRAV
Download sequence
Identical sequences F4HL44
gi|332159450|ref|YP_004424729.1| WP_013749275.1.68068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]