SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384261832|ref|YP_005417018.1| from Rhodospirillum photometricum DSM 122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384261832|ref|YP_005417018.1|
Domain Number 1 Region: 30-257
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.09e-52
Family Alanine racemase-like, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 251-382
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.49e-40
Family Alanine racemase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384261832|ref|YP_005417018.1|
Sequence length 396
Comment alanine racemase [Rhodospirillum photometricum DSM 122]
Sequence
MTAFIMETSASARLEDADARESRATARLTVDVDAIVANWRTVVSQVPPEVRAAGVLKSDA
YGCGARLVLPALAEAGCRDFFVALIDEGLAVRDLLPSGGRLFVLSGPPAGVEEAMMATGL
IPSLNSVQQLQAWAAAGRRRGTPAPAAWHVDTGMTRLGLDLPELAAAACDPELLTWAPPL
LLMSHLACADEPAHPQNAAQAEAFRHARTLLPEVEASLGNSAGTFLGPTFQGDLVRPGAA
LYGINPTPGRPSPVRPVVRLEARILQVRQIDTPRWVGYGASIRLPAGRRIATVGVGYADG
YPRAAGNQGVGVLAGIRVPVIGRVSMDLITLDVSAVPEHEARPGAMIDLLGADYTVDELA
AVAGTIGYEILTRLGPRCPRRVGSLPAALPGSGSSA
Download sequence
Identical sequences H6SJ83
gi|384261832|ref|YP_005417018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]