SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384261913|ref|YP_005417099.1| from Rhodospirillum photometricum DSM 122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384261913|ref|YP_005417099.1|
Domain Number 1 Region: 26-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.7e-74
Family Alanine racemase-like, N-terminal domain 0.00000883
Further Details:      
 
Domain Number 2 Region: 256-418
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.77e-53
Family Eukaryotic ODC-like 0.0000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384261913|ref|YP_005417099.1|
Sequence length 422
Comment diaminopimelate decarboxylase [Rhodospirillum photometricum DSM 122]
Sequence
MDHFTYKSGILHAEDVPLPRIAESVGTPFYVYSSATLEHHYRVITEAFTGQDAHVCFATK
TNGNKAVLTLLGRLGAGADVVSVGEMRHAIAAGIPAKRVVFSGVGKTRDELTAALSLGIA
QINVESEPELRALSEFASAMGTLAPVALRINPDVTADTHDKISTGRKENKFGIDWATAPA
LFRLANTLPGIDLKGVAVHIGSQILDLAPFRAAFLRLRELVLSLRGEGIALKRVDLGGGL
GVPYHRDDPSSPAPSAYAALAKECFGDLGVTLILEPGRLIAGNAGLLVSRVVYVKEGAAR
KFLILDAGFNDLVRPAMYDAYHEILPVEQPAPDAPYEPLDVVGPICETGDLFARQRPLPP
LAPDALVAFATAGAYGAAMSSTYNGRPLVPEVLVKGNRFDVVRRRPTLAEMTALESVPEW
LK
Download sequence
Identical sequences H6SJG4
gi|384261913|ref|YP_005417099.1| WP_014414768.1.535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]