SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319760462|ref|YP_004124400.1| from Candidatus Blochmannia vafer str. BVAF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319760462|ref|YP_004124400.1|
Domain Number 1 Region: 109-237
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.62e-37
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000272
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.52e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319760462|ref|YP_004124400.1|
Sequence length 241
Comment succinate dehydrogenase iron-sulfur subunit [Candidatus Blochmannia vafer str. BVAF]
Sequence
MKIKFSIYRFCPELNKVPYMQEFQINLINIYRMTLLDALIQLKEHDPTLTFRRSCREGVC
GSDGMNINGTNNLACITSLTELINRNPQKKIIIRPLPGFPVIRDLVVDMSQFYLQYQKIN
PYLINKDINKPSHEYLQSPEDRAKLDGSYECILCACCSSSCPSFWWNSDKFIGPAGLLTL
YRFLVDTRDTHSKERLKELQDSFSVFRCHNIMNCVSVCPKKLNPAQAIGKIKRMLVKNII
K
Download sequence
Identical sequences E8Q6X9
gi|319760462|ref|YP_004124400.1| WP_013516651.1.4849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]