SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319760570|ref|YP_004124508.1| from Candidatus Blochmannia vafer str. BVAF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319760570|ref|YP_004124508.1|
Domain Number 1 Region: 287-422
Classification Level Classification E-value
Superfamily CBS-domain pair 4.17e-23
Family CBS-domain pair 0.0061
Further Details:      
 
Domain Number 2 Region: 427-511
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000131
Family CorC/HlyC domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319760570|ref|YP_004124508.1|
Sequence length 525
Comment membrane transport protein [Candidatus Blochmannia vafer str. BVAF]
Sequence
MEFLTDLSMWAGFLTLVVLEVILGIDNLVFIAILADKLPKNQREHVCIVGLTLALIMRIT
LLSLVSWIATLTQPLFKVIAFSFSGRDLILLFGGFFLLFKATTELHQQLEHKMHSRHSER
GYASFWIVVIQIIVFDAIFSLDAVITAVGTVDRLSVMIIAVIVSVIIMLSMSRLLINFVN
NHQTVIVLCLSFLLIIGLSLMAEGIGFYIPKGYLYAAIGFSVLIELLNQIAYCNFMKNQS
NKSMRERTAEAIMKLMGGSSSASQWDFSEKKSSTFPLKTQFAEEERHMITGVLSLASRSL
RSIMTPRNEITWLDSQKSTQELYSVLTNTPHNMFPVCDGELDQLIGIVRAKDLMASISKG
KPVETYAAKNLPVVVPETLDVLNLLTELRRAKGSMVIVSNEFGVIQGLITPVDVLEAIAG
EFPDEDETPEIKTIDEKSWLVKGSTDLHALQQALKTYNLADICDHVASLAGLLLSRCDHI
PKEGDILIINEWRFIIKQMIEYRIELVEVERLYRVNDVFYEPKNF
Download sequence
Identical sequences E8Q710
WP_013516759.1.4849 gi|319760570|ref|YP_004124508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]