SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319760698|ref|YP_004124636.1| from Candidatus Blochmannia vafer str. BVAF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319760698|ref|YP_004124636.1|
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.41e-67
Family RecA protein-like (ATPase-domain) 0.0000000026
Further Details:      
 
Domain Number 2 Region: 48-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.85e-30
Family Cold shock DNA-binding domain-like 0.0000118
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000000192
Family Rho termination factor, N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319760698|ref|YP_004124636.1|
Sequence length 419
Comment transcription termination factor Rho [Candidatus Blochmannia vafer str. BVAF]
Sequence
MNLTKLKNIPVSELVKLGEGMGLENLARMRKQDIIFAIFKQHAKTGEDIFGDGVLEILQD
GFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNDVN
YDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP
KAGKTMLLQNIAQSISHNYPDCVLIVLLIDERPEEVTEMQRLVHGEVIASTFDEPASRHV
QVAEMVIEKAKRLVEHRKDVIILLDSITRLARAYNTIVPASGKVLTGGVDANALHRPKRF
FGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY
NRSGTRKEELLTTHDELQKIWILRKIIHPMGEIDAMEFMMNKLSMTKTNDEFFDMMKRC
Download sequence
Identical sequences E8Q6J3
gi|319760698|ref|YP_004124636.1| WP_013516887.1.4849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]