SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312127574|ref|YP_003992448.1| from Caldicellulosiruptor hydrothermalis 108

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|312127574|ref|YP_003992448.1|
Domain Number - Region: 6-54
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0288
Family TRAPP components 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312127574|ref|YP_003992448.1|
Sequence length 92
Comment hypothetical protein Calhy_1361 [Caldicellulosiruptor hydrothermalis 108]
Sequence
MSRDEFEEKLNDFILKLERMNFSYYVEYLKNPKKIIFSNFLSGAARGFGTAFGFSILGAL
LLYILNAIVKYNLPVIGRYIAEILKFVKFYMH
Download sequence
Identical sequences E4QAA7
WP_013403253.1.12921 gi|312127574|ref|YP_003992448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]