SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312127062|ref|YP_003991936.1| from Caldicellulosiruptor hydrothermalis 108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312127062|ref|YP_003991936.1|
Domain Number 1 Region: 627-825
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-20
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 370-613
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000639
Family Fibronectin type III 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|312127062|ref|YP_003991936.1|
Domain Number - Region: 167-267
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00359
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312127062|ref|YP_003991936.1|
Sequence length 1202
Comment Fibronectin type III domain-containing protein [Caldicellulosiruptor hydrothermalis 108]
Sequence
MKSIASKIVSIFLLISFLIALVPQNLIAQPAIVLPAPQSLNITLENNLPRMEVAQDGTIT
LYFSWQYSYSDFDYFELYLGDDPTRFPYGYTIYKNDPNLTVSNGSYTYKVQSLPNGQKIP
SGTIFYAKVRSVRVLQEQTGSVVYYSSYSNTIVFLTPIFVECYTNAEDAIDIVWDDVYYS
GKRIDYDIYVSKDISFTTPTKYQIDGDRITLLQSQKPGGRVEILPGRKLKYTAAGLSPSS
LYYVKVLPRNLPQEVIWRDPQTYTPPNIKVIGEAATYIQAEAQRIADNVVWLRWAKVSIA
ENEYEIYKGSKDQIPTLIGTVSANEFFAVVSITDDVFFRIQVDVFDSFGRKVSIRSKDLY
VHPYTLPFAPPAAENLTAFPKSQDTISLRFKIPTDKEVVYDFYYKKYSDNNADFISFVSN
YQMKSSDEEKDENNLPTGYYRFDITGLEKNTVYVLKVVVKKKFYDYEQGTYIYKESTPAL
TISYTLSGDITPPTTPTLLSVVYTTYDSVVLSWQPITIAGVQPPTVDRSIFYEVNFAVYQ
DGMDITNPENLDTASFQKIILSDYQIDQSGKVVFRVSNLLPNTRYVFFVRSMRKIDSSIY
YSLPSNVVMATTLIKYEVPLPSSVPVVENLSVVTTTYNSALLSWSYIENVYFEIQVSEDI
KNANAWQVASDSFKPPIKEVDYTTGLCYFTVQNLKPDTLYYFRVRAYIIKDNQKVYSEFS
SPVFGRTQKVPPPKTPVAFGIKDYGKDYAIFVWEMAETGRRYVIEIADNISFSNSQKYTT
DTDATEYKVTGLKPNTRYWARLFAIASDGQLSQSTEIISFVTKKDVSEYTGVFDSVQDTT
LPFITVEDPATGKMIIEITYRYVNESLDSKPVSIDFTKRTNQSIYQFVIKMRYDVLKALV
KLNKDCIVTLDGASSQFSFTAIDSSDINKLTVSGVSPSSIYSELTFIKASDKYNVKDAVS
EVYDIRYTASSLTKQVGISYFPMPIKISLVNREPWSVAIPYVFDLTSLSWKEPDGVEFAS
DNKSVTFNLQTPQATVIVRKSFYKDIISSSYATKLYNLFKTIPSDDTSDTIGIKSAVSKQ
ELASFLVYFAEKKRLYRFEIIDDYVKKAYKSGLIENTQDNSILTKEAAVDMMVKFYEIYT
GNEISADNVAWTKLSADDKYILSLKKAYKMGWLFDYVTFNPKETATREYVLAFFYHVVTS
MQ
Download sequence
Identical sequences E4QE73
WP_013402764.1.12921 gi|312127062|ref|YP_003991936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]