SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|554643193|ref|YP_008714984.1| from Staphylococcus aureus subsp. aureus Z172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554643193|ref|YP_008714984.1|
Domain Number 1 Region: 2-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-70
Family G proteins 0.0000322
Further Details:      
 
Domain Number 2 Region: 416-532
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-22
Family Translational machinery components 0.0026
Further Details:      
 
Domain Number 3 Region: 342-418
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-16
Family EF-G/eEF-2 domains III and V 0.0014
Further Details:      
 
Domain Number 4 Region: 535-618
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000767
Family EF-G/eEF-2 domains III and V 0.015
Further Details:      
 
Domain Number 5 Region: 224-317
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000141
Family Elongation factors 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|554643193|ref|YP_008714984.1|
Sequence length 639
Comment Tetracycline resistance protein TetM [Staphylococcus aureus subsp. aureus Z172]
Sequence
MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGI
TSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKMG
IPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIE
GNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYS
STHRGPSELCGNVFKIEYTKKRQRLAYIRLYSGVLHLRDSVRVSEKEKIKVTEMYTSING
ELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQRKKIENPHPLLQTTVEPSKPEQREM
LLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVISALLQEKYHVEIELKEPTVIY
MERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGMQYESSVSLGYLNQSFQNAVMEG
IRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLTPIVLEQAFRKAGTELLEPYL
SFKVYAPQEYLSRAYNDAPKYCANIVNTQLKNNEVIIIGEIPARCIQDYRNDLTFFTNGL
SVCLAELKGYQVTTGEPVCQTRRLNSRIDKVRYMFNKIT
Download sequence
Identical sequences A0A0E1AHA5 A0A0M2AWS0 A0A1H4A1R4 A0A1J7WV46 A0A1L6XCR5 A0A1U7E9J8 A0A1Y3JJT0 A0A2I0Y4N4 B0YMX3 B5TGI4 N1K133 Q932I8 R2Q4U8 T4IHX8 U7U7R7
gi|384868977|ref|YP_005751691.1| WP_000691737.1.100090 WP_000691737.1.100093 WP_000691737.1.100267 WP_000691737.1.100352 WP_000691737.1.100520 WP_000691737.1.100913 WP_000691737.1.100963 WP_000691737.1.101757 WP_000691737.1.101788 WP_000691737.1.101870 WP_000691737.1.101950 WP_000691737.1.101956 WP_000691737.1.10486 WP_000691737.1.10519 WP_000691737.1.10846 WP_000691737.1.11177 WP_000691737.1.11343 WP_000691737.1.1136 WP_000691737.1.11941 WP_000691737.1.12178 WP_000691737.1.12179 WP_000691737.1.12226 WP_000691737.1.12249 WP_000691737.1.12862 WP_000691737.1.12872 WP_000691737.1.1293 WP_000691737.1.13042 WP_000691737.1.13064 WP_000691737.1.13167 WP_000691737.1.1355 WP_000691737.1.13658 WP_000691737.1.13726 WP_000691737.1.13914 WP_000691737.1.14071 WP_000691737.1.14103 WP_000691737.1.14182 WP_000691737.1.14365 WP_000691737.1.15070 WP_000691737.1.15199 WP_000691737.1.15228 WP_000691737.1.15255 WP_000691737.1.15760 WP_000691737.1.1633 WP_000691737.1.16595 WP_000691737.1.16679 WP_000691737.1.16757 WP_000691737.1.16793 WP_000691737.1.1681 WP_000691737.1.16976 WP_000691737.1.17488 WP_000691737.1.17520 WP_000691737.1.17607 WP_000691737.1.17650 WP_000691737.1.17707 WP_000691737.1.17815 WP_000691737.1.17898 WP_000691737.1.18197 WP_000691737.1.18362 WP_000691737.1.18538 WP_000691737.1.18627 WP_000691737.1.18830 WP_000691737.1.19073 WP_000691737.1.19086 WP_000691737.1.19390 WP_000691737.1.19411 WP_000691737.1.19788 WP_000691737.1.19807 WP_000691737.1.19853 WP_000691737.1.20354 WP_000691737.1.20458 WP_000691737.1.20726 WP_000691737.1.21081 WP_000691737.1.21087 WP_000691737.1.21711 WP_000691737.1.22332 WP_000691737.1.22351 WP_000691737.1.23126 WP_000691737.1.23626 WP_000691737.1.2365 WP_000691737.1.24296 WP_000691737.1.24441 WP_000691737.1.24631 WP_000691737.1.24977 WP_000691737.1.25182 WP_000691737.1.25303 WP_000691737.1.2555 WP_000691737.1.25648 WP_000691737.1.25867 WP_000691737.1.25949 WP_000691737.1.25973 WP_000691737.1.26029 WP_000691737.1.26056 WP_000691737.1.26153 WP_000691737.1.26561 WP_000691737.1.26786 WP_000691737.1.27042 WP_000691737.1.27184 WP_000691737.1.27325 WP_000691737.1.2768 WP_000691737.1.27717 WP_000691737.1.27751 WP_000691737.1.28025 WP_000691737.1.28197 WP_000691737.1.28230 WP_000691737.1.28359 WP_000691737.1.2844 WP_000691737.1.28477 WP_000691737.1.28613 WP_000691737.1.28630 WP_000691737.1.28685 WP_000691737.1.28725 WP_000691737.1.28991 WP_000691737.1.29487 WP_000691737.1.29771 WP_000691737.1.30012 WP_000691737.1.30047 WP_000691737.1.30154 WP_000691737.1.30275 WP_000691737.1.3028 WP_000691737.1.30321 WP_000691737.1.30375 WP_000691737.1.30388 WP_000691737.1.3052 WP_000691737.1.30560 WP_000691737.1.30779 WP_000691737.1.31108 WP_000691737.1.31250 WP_000691737.1.31894 WP_000691737.1.31904 WP_000691737.1.31990 WP_000691737.1.32454 WP_000691737.1.32511 WP_000691737.1.33105 WP_000691737.1.33372 WP_000691737.1.33394 WP_000691737.1.33590 WP_000691737.1.33737 WP_000691737.1.33994 WP_000691737.1.34221 WP_000691737.1.34828 WP_000691737.1.34847 WP_000691737.1.35451 WP_000691737.1.35519 WP_000691737.1.36208 WP_000691737.1.36594 WP_000691737.1.36776 WP_000691737.1.36814 WP_000691737.1.37546 WP_000691737.1.37547 WP_000691737.1.38076 WP_000691737.1.38437 WP_000691737.1.3845 WP_000691737.1.38458 WP_000691737.1.3875 WP_000691737.1.3927 WP_000691737.1.39330 WP_000691737.1.39495 WP_000691737.1.39642 WP_000691737.1.39656 WP_000691737.1.39673 WP_000691737.1.40005 WP_000691737.1.40015 WP_000691737.1.40099 WP_000691737.1.40514 WP_000691737.1.40650 WP_000691737.1.40765 WP_000691737.1.40774 WP_000691737.1.41329 WP_000691737.1.41338 WP_000691737.1.41612 WP_000691737.1.41796 WP_000691737.1.41867 WP_000691737.1.4202 WP_000691737.1.42344 WP_000691737.1.42540 WP_000691737.1.42686 WP_000691737.1.42788 WP_000691737.1.43692 WP_000691737.1.43995 WP_000691737.1.44777 WP_000691737.1.44940 WP_000691737.1.44990 WP_000691737.1.45058 WP_000691737.1.45103 WP_000691737.1.45150 WP_000691737.1.4544 WP_000691737.1.45553 WP_000691737.1.45650 WP_000691737.1.45899 WP_000691737.1.45972 WP_000691737.1.45979 WP_000691737.1.46043 WP_000691737.1.46050 WP_000691737.1.46230 WP_000691737.1.47497 WP_000691737.1.47528 WP_000691737.1.47584 WP_000691737.1.47708 WP_000691737.1.48064 WP_000691737.1.48120 WP_000691737.1.48338 WP_000691737.1.48416 WP_000691737.1.48471 WP_000691737.1.48518 WP_000691737.1.48664 WP_000691737.1.48674 WP_000691737.1.48723 WP_000691737.1.4924 WP_000691737.1.49371 WP_000691737.1.4945 WP_000691737.1.50178 WP_000691737.1.5019 WP_000691737.1.50420 WP_000691737.1.51125 WP_000691737.1.51226 WP_000691737.1.51271 WP_000691737.1.51741 WP_000691737.1.51844 WP_000691737.1.5246 WP_000691737.1.52514 WP_000691737.1.5286 WP_000691737.1.52973 WP_000691737.1.53013 WP_000691737.1.53463 WP_000691737.1.5347 WP_000691737.1.53532 WP_000691737.1.53836 WP_000691737.1.54289 WP_000691737.1.54290 WP_000691737.1.5437 WP_000691737.1.54750 WP_000691737.1.54757 WP_000691737.1.54830 WP_000691737.1.54844 WP_000691737.1.54851 WP_000691737.1.54929 WP_000691737.1.54978 WP_000691737.1.55327 WP_000691737.1.55542 WP_000691737.1.55753 WP_000691737.1.55775 WP_000691737.1.55921 WP_000691737.1.56011 WP_000691737.1.56159 WP_000691737.1.56192 WP_000691737.1.56200 WP_000691737.1.56208 WP_000691737.1.56265 WP_000691737.1.564 WP_000691737.1.56718 WP_000691737.1.56737 WP_000691737.1.56779 WP_000691737.1.56930 WP_000691737.1.5718 WP_000691737.1.57449 WP_000691737.1.58185 WP_000691737.1.58255 WP_000691737.1.58297 WP_000691737.1.58304 WP_000691737.1.58481 WP_000691737.1.58520 WP_000691737.1.58603 WP_000691737.1.58928 WP_000691737.1.58998 WP_000691737.1.59783 WP_000691737.1.59881 WP_000691737.1.59937 WP_000691737.1.60022 WP_000691737.1.60058 WP_000691737.1.60156 WP_000691737.1.60393 WP_000691737.1.60535 WP_000691737.1.60940 WP_000691737.1.6096 WP_000691737.1.61032 WP_000691737.1.6131 WP_000691737.1.61413 WP_000691737.1.61433 WP_000691737.1.61581 WP_000691737.1.62362 WP_000691737.1.62756 WP_000691737.1.62781 WP_000691737.1.63086 WP_000691737.1.63182 WP_000691737.1.63233 WP_000691737.1.63319 WP_000691737.1.63345 WP_000691737.1.63383 WP_000691737.1.63394 WP_000691737.1.6360 WP_000691737.1.63668 WP_000691737.1.63883 WP_000691737.1.64256 WP_000691737.1.64352 WP_000691737.1.64628 WP_000691737.1.64643 WP_000691737.1.64956 WP_000691737.1.64994 WP_000691737.1.64998 WP_000691737.1.65010 WP_000691737.1.6502 WP_000691737.1.65139 WP_000691737.1.65264 WP_000691737.1.65448 WP_000691737.1.66680 WP_000691737.1.67002 WP_000691737.1.6726 WP_000691737.1.67277 WP_000691737.1.67328 WP_000691737.1.67460 WP_000691737.1.67518 WP_000691737.1.67806 WP_000691737.1.67834 WP_000691737.1.68004 WP_000691737.1.68197 WP_000691737.1.68414 WP_000691737.1.68512 WP_000691737.1.68542 WP_000691737.1.68548 WP_000691737.1.68905 WP_000691737.1.69214 WP_000691737.1.69490 WP_000691737.1.69705 WP_000691737.1.69734 WP_000691737.1.70021 WP_000691737.1.70059 WP_000691737.1.70468 WP_000691737.1.70664 WP_000691737.1.71721 WP_000691737.1.71863 WP_000691737.1.71899 WP_000691737.1.72026 WP_000691737.1.72036 WP_000691737.1.722 WP_000691737.1.72204 WP_000691737.1.72340 WP_000691737.1.7254 WP_000691737.1.72930 WP_000691737.1.73002 WP_000691737.1.73260 WP_000691737.1.7350 WP_000691737.1.7360 WP_000691737.1.73621 WP_000691737.1.73625 WP_000691737.1.74356 WP_000691737.1.74375 WP_000691737.1.74584 WP_000691737.1.74994 WP_000691737.1.75235 WP_000691737.1.7530 WP_000691737.1.7587 WP_000691737.1.76033 WP_000691737.1.76222 WP_000691737.1.7627 WP_000691737.1.76334 WP_000691737.1.76674 WP_000691737.1.76686 WP_000691737.1.76747 WP_000691737.1.77005 WP_000691737.1.77031 WP_000691737.1.77158 WP_000691737.1.77187 WP_000691737.1.77493 WP_000691737.1.77893 WP_000691737.1.78335 WP_000691737.1.78464 WP_000691737.1.78579 WP_000691737.1.78662 WP_000691737.1.78758 WP_000691737.1.78990 WP_000691737.1.791 WP_000691737.1.79117 WP_000691737.1.79372 WP_000691737.1.79581 WP_000691737.1.79703 WP_000691737.1.80210 WP_000691737.1.80340 WP_000691737.1.80361 WP_000691737.1.80889 WP_000691737.1.81049 WP_000691737.1.81222 WP_000691737.1.81290 WP_000691737.1.81837 WP_000691737.1.81999 WP_000691737.1.82535 WP_000691737.1.82982 WP_000691737.1.83086 WP_000691737.1.8340 WP_000691737.1.83429 WP_000691737.1.83494 WP_000691737.1.83649 WP_000691737.1.83723 WP_000691737.1.8385 WP_000691737.1.8439 WP_000691737.1.84651 WP_000691737.1.84922 WP_000691737.1.84924 WP_000691737.1.85015 WP_000691737.1.85030 WP_000691737.1.85118 WP_000691737.1.85358 WP_000691737.1.85585 WP_000691737.1.85605 WP_000691737.1.8568 WP_000691737.1.862 WP_000691737.1.86209 WP_000691737.1.86333 WP_000691737.1.8636 WP_000691737.1.86400 WP_000691737.1.86473 WP_000691737.1.86511 WP_000691737.1.86565 WP_000691737.1.86635 WP_000691737.1.86779 WP_000691737.1.87204 WP_000691737.1.87395 WP_000691737.1.87482 WP_000691737.1.87697 WP_000691737.1.87810 WP_000691737.1.88262 WP_000691737.1.88357 WP_000691737.1.8861 WP_000691737.1.88744 WP_000691737.1.88960 WP_000691737.1.89125 WP_000691737.1.89262 WP_000691737.1.89908 WP_000691737.1.90136 WP_000691737.1.90494 WP_000691737.1.90661 WP_000691737.1.90749 WP_000691737.1.9125 WP_000691737.1.9126 WP_000691737.1.91287 WP_000691737.1.91969 WP_000691737.1.93358 WP_000691737.1.93607 WP_000691737.1.94179 WP_000691737.1.9430 WP_000691737.1.94324 WP_000691737.1.94389 WP_000691737.1.94427 WP_000691737.1.94457 WP_000691737.1.94868 WP_000691737.1.95008 WP_000691737.1.95281 WP_000691737.1.95328 WP_000691737.1.95394 WP_000691737.1.9563 WP_000691737.1.95658 WP_000691737.1.95914 WP_000691737.1.95993 WP_000691737.1.96475 WP_000691737.1.96688 WP_000691737.1.96780 WP_000691737.1.96868 WP_000691737.1.96943 WP_000691737.1.96976 WP_000691737.1.97295 WP_000691737.1.97411 WP_000691737.1.9752 WP_000691737.1.97630 WP_000691737.1.97928 WP_000691737.1.98379 WP_000691737.1.98512 WP_000691737.1.98938 WP_000691737.1.98940 WP_000691737.1.99032 WP_000691737.1.99149 WP_000691737.1.99286 WP_000691737.1.99459 WP_000691737.1.99638 WP_000691737.1.99759 gi|387142085|ref|YP_005730478.1| gi|554643193|ref|YP_008714984.1| 158878.SAV0398 418127.SAHV_0395 gi|15923388|ref|NP_370922.1| ZR340 gi|156978726|ref|YP_001440985.1| gi|386320318|ref|YP_006016481.1| gi|384517246|ref|YP_005704551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]