SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313673978|ref|YP_004052089.1| from Calditerrivibrio nitroreducens DSM 19672

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313673978|ref|YP_004052089.1|
Domain Number 1 Region: 183-375
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.59e-86
Family GroEL-like chaperone, apical domain 0.00000044
Further Details:      
 
Domain Number 2 Region: 6-133,405-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.15e-80
Family GroEL chaperone, ATPase domain 0.00000393
Further Details:      
 
Domain Number 3 Region: 136-202
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.33e-23
Family GroEL-like chaperone, intermediate domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313673978|ref|YP_004052089.1|
Sequence length 541
Comment chaperonin groel [Calditerrivibrio nitroreducens DSM 19672]
Sequence
MAKAITFSEEARQAILRGVDKLANAVKVTLGPKGRNVVIEKKFGSPLVTKDGVTVAKEIE
LKDALENLGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGIKNVVAGSNPMDLKRGID
KAVEAVVAELKKMSKPIQGKKEIAQVGTISANNDPEIGNIIADAMERVGKDGVITIEENK
STDTVLDVVEGMQFDRGYLSPYFVTDPENMEAILENPYLLICDKKISNMKELLPILEQLA
KQNAPFLIIAEDIEGEALATLVVNKLRGTLNCCAVKAPGFGDRRKEMLKDIAILTGGQVI
SEELGLKLENAKLSDLGRAKKVVVEKENTTIVEGAGKTEDIQARVNVIKKQIEETTSDYD
REKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATKAAVEEGIVPGGGVALLR
ASRAIANLKDLTPDQKVGADIVRRALEYPVRQIASNAGFEGSIVVNKILEAEKDTFGFDA
HAEIYTDMIEAGIIDPTKVTRSALQNAASVAGLMLTTEAMITEIPEKKEPAMPNPGMGMD
M
Download sequence
Identical sequences E4THR5
gi|313673978|ref|YP_004052089.1| WP_013452133.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]