SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307719264|ref|YP_003874796.1| from Spirochaeta thermophila DSM 6192

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307719264|ref|YP_003874796.1|
Domain Number 1 Region: 44-331,405-472
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-89
Family Type II chitinase 0.00000882
Further Details:      
 
Domain Number 2 Region: 600-643
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000209
Family Carbohydrate binding domain 0.00042
Further Details:      
 
Domain Number 3 Region: 505-553
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000379
Family Carbohydrate binding domain 0.0048
Further Details:      
 
Domain Number 4 Region: 323-396
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000931
Family Chitinase insertion domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307719264|ref|YP_003874796.1|
Sequence length 644
Comment glycosyl hydrolases family 18 [Spirochaeta thermophila DSM 6192]
Sequence
MKRSFLCVLLAGGLLLIGGCLVPLGPSEREGGESARAAAGGLPYHIVVYFPEWGIYAGHN
YYYPEHVPFEYITHLNYAFLEIKKVGTNQFQLGIIDSWASLQKAYGTWDQTERMGNIREL
KYQRDLRNPNVKLLFSVGGWSRSGYFSEMAYTPEGRASFIQSCIEYLRTYGYDGIDIDWE
WPGVYRAPSNSPPGDQGNPVYGTPEEDKRNFTLLLKELRAALDQAGQQDGKHYLLTVAVG
AGKDKIDMTEPNVYHQYVDYIGLMTYDFHGGWENVTNHQSPLYPNPNDPSEYRDTYNIDW
VVKYFSGQYSVPKEKLVVGLPYYSRGWKGVDPNTGINGLFAQAQGAADTGAWDGHTAPYY
QTRAWGQGADGFIRYWDDTAKVPWLYNPSTGYMWTFEDLESITIKANYLKQNGYGGFLIW
DITGDYPNVANGEKGAELTKAIYELFGGDSVPSPTPTPSTTPTPSPTPTATPSPTPTPTP
TSTPTSTPSPTPTPTVTPTPTPTGTAYPVWDPSQVYVGGDRVYWNGHNWEARWWTKGEEP
GTTGEWGVWKDLGPAEGATPSPTPTPTPTPTPTATPTPTSTMTPTPTASPTPTPSGGPAE
WQAYTAYAVGDRVSYGGVVYRCLQAHTSLPGWEPPNAPALWQAE
Download sequence
Identical sequences E0RN54
gi|307719264|ref|YP_003874796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]