SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315037587|ref|YP_004031155.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315037587|ref|YP_004031155.1|
Domain Number 1 Region: 8-347
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.66e-63
Family TK-like PP module 0.018
Further Details:      
 
Domain Number 2 Region: 290-451
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.03e-34
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.018
Further Details:      
 
Domain Number 3 Region: 463-579
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000116
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315037587|ref|YP_004031155.1|
Sequence length 580
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Lactobacillus amylovorus GRL 1112]
Sequence
MNKHPEYLLNKISGPKDLKKLSIPEMEELAKEIRTLILEKDAAEGGHLGPDLGIVEATIA
YHYVFDAPKDKIVWDVSHQTYPHKMLTGRALAWIDPDHYEDVTPYTNPDESPYDYYAVGH
TSTSIALATGMAKARDLMGRHENIMALIGDGSMTGGLAYEGLNNAVIEKHNIVVVVNDNQ
MSIDENVGGLVTALKKLRDSNGETKENPFTAMGFDYRYVADGNDVKSMIDAFKAVKDVDH
PILLHINTLKGKGYEPAIDNEEAHHWVMPFDLKTDKTTVPAPEGPTANSVAMDVMKKHIE
NGEKIMAIDAAIPGVFGLDEIKDKYPENYHDVGIAEQESVAFAAGMAKEGAVPVLFENST
FLQRAFDQLSHDVAANDLPVVMMVAGGGMSGTSKTHLGIFDQVMISNLPNWIYLAPTTLA
EEKDMMEWAIKQRKHPVAIKMPTKRVPAGKDVSRDYSEIKYDIKPGNDVAVLALGDMYEM
LGKEVAEKLGASLVNPISANILDTASLDKLADENKVIVTLEDNILDGGFGEKVASYLGDK
DVKVLNYGQKRVYTDQVPLKDILKDNRMTVDQIVEDVKNA
Download sequence
Identical sequences E4SL24 R5YHZ0
gi|315037587|ref|YP_004031155.1| WP_013437175.1.47126 WP_013437175.1.62722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]