SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315037831|ref|YP_004031399.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315037831|ref|YP_004031399.1|
Domain Number 1 Region: 4-375
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.69e-64
Family TK-like PP module 0.017
Further Details:      
 
Domain Number 2 Region: 383-600
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.12e-35
Family TK-like Pyr module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315037831|ref|YP_004031399.1|
Sequence length 798
Comment phosphoketolase [Lactobacillus amylovorus GRL 1112]
Sequence
MTNYDSKEYLKSVDAYWRAANYLSVGQLFLMKNPLLKKPLTAEDVKPKPIGHWGTIAPQN
FIYAHLNRVLKKYNLDMFYIEGSGHGGQVMVSNSYLDGSYTERYPEITQDEKGMAKLFKR
FSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAVLDNPDVIAAVEIGDGEAETGPLAA
SWFSDKFINPIKDGAVLPILQINGFKISNPTIVSRMSDEELTEYFRGMGWDPHFVSVFKG
GRFDGEKDPMQVHEEMAKTMDEVIEEIKAIQKHARENNDASLPHWPLIIFQCPKGWTGPK
KDLDGNPIENSFRAHQIPIPVSQGDMKHADMLTDWLESYKPEELFNEDGSPKEIVTENTA
EGDHRMAMNPITNGGKDPKRLNLPDYRDFALKFDKPGSMEAQDMVEWAKYLDEVAKLNPT
TFRGFGPDESKSNRLFQLLDNQKRQWEPEIHEPNDENLAPSGRVIDSQLSEHQDEGFLEG
YVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQYWRHDYPSLNFVATSTVFQQDHN
GYTHQDPGILTHLYEKNRPDLIHEYLPSDTNTLLAVGDKAFKDRECINVLVTSKQPRPQW
FSIEEAQKLVDKGLGYIDWASTDKGAKPDVVFASTETEPTIETLAAIDILHDKFPDLKIR
YINVVDVMKLMSPKDNKNAISDEEFDRLFPKDVPVILAWHGYKSMMQSIWFDRKRYNVHI
HCYEENGDITTPFDMRVLNHLDRFDLAKDAVESVAKLKGKNADFISHMDDLLEKHHQYIR
DNGKDMPEVTEWKWKGLK
Download sequence
Identical sequences E4SMM8
WP_013437410.1.62722 gi|315037831|ref|YP_004031399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]