SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315038046|ref|YP_004031614.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315038046|ref|YP_004031614.1|
Domain Number 1 Region: 256-597
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.41e-87
Family beta-Lactamase/D-ala carboxypeptidase 0.000000795
Further Details:      
 
Domain Number 2 Region: 65-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.57e-47
Family Penicillin binding protein dimerisation domain 0.0000378
Further Details:      
 
Domain Number 3 Region: 605-661
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0082
Further Details:      
 
Domain Number 4 Region: 664-719
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315038046|ref|YP_004031614.1|
Sequence length 720
Comment cell division protein FtsI/penicillin-binding protein 2 [Lactobacillus amylovorus GRL 1112]
Sequence
MKKNSNLKLQKSKAHSYRFTVGRFLQVAVALVFLVFTARFLYIGISKTVNGENLSERTKE
LYKRNQIIKATRGTIYDRNGLAIAEESHLYTIYAILDKSSINYKNKPEYVVNKSETAEKL
AKVLPMSADKIYQYLTPKHKAFQVQFGTAGSGLTSKQKKKIEAMKLPGIKFLATPSRLYP
NGNFASHVVGLAQPIYDKKTNAQNLVGTMGIEAYFNKTLTGTDGYRISSVDASEYQMPNG
NQVYKPVKNGNNLYLTLDSQLQSYLESHLTDVQKAYSPTSMTAVVEDMKTGKILAASQRP
TFNPQTRKGLTKAYRNILVQDTYEPGSVFKVLSFAAVVNSGNYNPNEYYRSGSVNIGGST
IHDWLTSGWGTIPFSQAFERSSNTGFVKLEQKMGAKTWKKYLKKFHIGEKTGITLPGEQP
GFISFKTPVDQAVTAFGQGVNVNVMQMMQAYSSLANNGQMVKPQLVDKITDSNGKTIKGY
EIKKVGSPVYSNKTKKIVLANMKKVLNKQSGTGNAYKMGNADIGVKTGTAQIANPKGGGY
LKGDSNYIFSVVGVYPASSPRYCIYLTLKQPHLGGGATAEKILASIFKPMMSRIISMSKN
DNASTTVKVPNFKGMTYNQAAAKANQIGLNIVKVGSGKKIIDQGIKKGERLESGDKIFVS
TSGKVTCPDMRGWSINDLYEFANLTGVKFSMKGTGTVASQDVAKGTEIKAEKKIKVNLKE
Download sequence
Identical sequences E4SI20
gi|315038046|ref|YP_004031614.1| WP_013437623.1.47126 WP_013437623.1.62722 WP_013437623.1.98135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]