SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315037367|ref|YP_004030935.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315037367|ref|YP_004030935.1|
Domain Number 1 Region: 100-251
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.54e-32
Family Ribonuclease H 0.00026
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000000272
Family N-terminal domain of RNase HI 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315037367|ref|YP_004030935.1|
Sequence length 254
Comment ribonuclease HI [Lactobacillus amylovorus GRL 1112]
Sequence
MKIYAVKKGRVPGVYRNWDEAKKQVDGFSGAEYKSFENITDAIDYLGWQEKSHEETINRK
DDTLENAIEKIKHNSKKPVKATKNKKTKKQNTQSSEYFATTYTDGGTRNTGVYKGGHVKK
TDKAAWAYLIEWDGGSEDGSGGEYGATNNKMEQTALINALKKLIELGFNEKHLLFVLDSK
YVLNAINQHWLQGWKKRGWKRSSGPLKNVPEWKELDRLLQSFPDSTFEWTKGHANNRGNE
YVDHALNRYMDEHM
Download sequence
Identical sequences E4SJS0 R5Z026
WP_013436971.1.62722 gi|315037367|ref|YP_004030935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]