SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315037626|ref|YP_004031194.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315037626|ref|YP_004031194.1|
Domain Number 1 Region: 193-352
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.02e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 6-168
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.69e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000202
Further Details:      
 
Domain Number 3 Region: 369-544
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.68e-39
Family Pyruvate oxidase and decarboxylase PP module 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315037626|ref|YP_004031194.1|
Sequence length 570
Comment oxalyl-CoA decarboxylase [Lactobacillus amylovorus GRL 1112]
Sequence
MVDNTSLTGAALLIDALQANGLNNMYGVVGIPVTDFARLAELKGMKFYGFRREDSAVDAA
AAAGFITGKPGVALTVSAPGFLNGLTALAQATKNCFPLIMISGSSDRHIIDLDRGDYEGL
DQYNVAKPFCKAAYRVDRAEDMGLAVARAVRTAVSGRPGGVYLDLPAATVSDTVAQKSDA
NIYKVVDPAPKQLPSDEAINRAVELLNNAKHPVLLLGKGAAYAQAEDEIRELVAKTNIPF
LPMSMAKGVVPDDSPASAASARSFTLGQADVVLLVGARLNWMLSNGGSPLFSPDAKFIQV
DIDATEFDSNRKIDAPLQGDIKSVMQKFNSAVIDAGVKAPQDWLDQIKTESEKNNTKFAK
RISASEAKPTLGFYSAIEPINDLLQKHPDTYIVSEGANTLDIGRNLISMQKPRHRLDTGT
WGVMGVGMGYAIATAVETGKPVIALEGDSAFGFDGMEMETICRYHLPVIVVVVNNGGIYN
GDVNVVPDQPGPTVLDHDAHYGDIAKAFGGDSYRVNNYTEMKDALEKAYESGNPTIIDAQ
IPASMGKESGHIGNLNPKLDLSSLEEKENK
Download sequence
Identical sequences A0A0R2KYZ0 E4SLE1 F0TIS2
WP_013437212.1.47126 WP_013437212.1.62722 WP_013437212.1.69766 WP_013437212.1.98135 gi|325956106|ref|YP_004286716.1| gi|315037626|ref|YP_004031194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]