SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315039279|ref|YP_004032847.1| from Lactobacillus amylovorus GRL 1112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315039279|ref|YP_004032847.1|
Domain Number 1 Region: 360-568
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.68e-51
Family Pyruvate oxidase and decarboxylase PP module 0.0000199
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.45e-41
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000866
Further Details:      
 
Domain Number 3 Region: 185-353
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.37e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315039279|ref|YP_004032847.1|
Sequence length 602
Comment pyruvate oxidase [Lactobacillus amylovorus GRL 1112]
Sequence
MTKINGSDAMLKVIYDWGIDHIYGFPGGSFDSSMNAIYDFRDKMKFIEVRHEEAGALAAS
SEYKVTGKLGVCFGSAGPGAAHLFNGLYDAKFDKTPMLAIVANVPTSKQDIDFFQAFDED
KWFLDASVWCASAKTPELIPVLTDEAIRQAYARKGPAVLIIPKDYGWQKIEDNFRVNKDA
HPEPNYPAPTKTSVDEAVKLLREAKNPTMYIGLGAKDAGEEVKEFAEKFKTPIMSSYLGK
GVVEDKFPAYMGTIGRIGPKVAQEVQMATDLVVWVGNNSPFSVLWFPKNAKVIQIDVDPA
KFGKRHSTDVSMLADAKKALRAIIDAGEERNESPLYKAAIADRENWDAWEDSFKNSDEMP
VRQEPIWDVINKKADDNAVFAIDVGNVNVDSCRLLNLHDDQKWTTSGLHATMGYGAPAAL
MAATVYPDREVWNLAGDGGFAMMNQELLTMSRYNMHILNVVFTNETLGYIEAEQVDESHQ
PLSGVKLPDNDWAKVAEGMNVKGVVVRTKKEFEEAVDEFKKIDGPMLIDVKYTHNMPYST
ELNSLDDPAFVKKYEAEDLKPFSYFAEKYGLEADAATGASQHEESEPEEDTAPDTVSGAS
QH
Download sequence
Identical sequences E4SNW1
gi|315039279|ref|YP_004032847.1| WP_013438812.1.62722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]