SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320333799|ref|YP_004170510.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320333799|ref|YP_004170510.1|
Domain Number 1 Region: 330-555
Classification Level Classification E-value
Superfamily PHP domain-like 9.68e-43
Family PHP domain 0.0035
Further Details:      
 
Domain Number 2 Region: 57-144
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000000549
Family Achaeal helicase C-terminal domain 0.0079
Further Details:      
 
Domain Number 3 Region: 3-75
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000131
Family DNA polymerase beta, N-terminal domain-like 0.0096
Further Details:      
 
Domain Number 4 Region: 157-304
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000569
Family DNA polymerase beta-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320333799|ref|YP_004170510.1|
Sequence length 562
Comment PHP domain-containing protein [Deinococcus maricopensis DSM 21211]
Sequence
MDKKQVLGVLEATAEVLELLGESEFRVRAYRGAVRGLEATEEDWAALLASGFAGVRGVGP
GTRAELQALAETGVFMPFEEAAALIPPGVLTLLRVRGLGPKKVRALWDAGIDSLEALREA
ARDGRLAALKGFGAKTAVKLLEGAEFALAMQARQHLSVGVRIVETLTEALAGLEPRAAGG
VRRAAETIEDAQVTVTGTAEAVRARLTGLLSDVADHPDLPALTGRLDGVPVEVGYAASDA
RGALDVLYGGGRVFREKLVQDAARQGFALTATGLRRGDALTPTPAEADVFATLGRTCPPA
EYREPEHEGLLDALPGAEALITVRDIRGMLHTHSTWSDGTAGIREMAEEAVRRGHAFLGT
GDHSVSAHYANGLSIARLREQLREVRELQRAGVPLVAGSEVDILEDGTLDFPDDVLAELD
YVVASVHSRFDLPADAQTARIVRAAQHPLVTILGHPTGRLLVRRPGYALDLDAVMAACAA
AGTVVEINASPYRLDVDWRVALAWRGRVRFAINTDAHVPAGLGDARYGVMVARKAGLTPE
DVVNSLDREAFLAFVAQQRAAR
Download sequence
Identical sequences E8U706
gi|320333799|ref|YP_004170510.1| WP_013556350.1.15749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]