SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320334538|ref|YP_004171249.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320334538|ref|YP_004171249.1|
Domain Number 1 Region: 10-400
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 3.66e-113
Family Homocysteine S-methyltransferase 0.00000576
Further Details:      
 
Domain Number 2 Region: 899-1205
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.31e-105
Family Methionine synthase SAM-binding domain 0.000000109
Further Details:      
 
Domain Number 3 Region: 357-631
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.62e-83
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0012
Further Details:      
 
Domain Number 4 Region: 742-873
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.92e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000325
Further Details:      
 
Domain Number 5 Region: 652-738
Classification Level Classification E-value
Superfamily Methionine synthase domain 4.32e-27
Family Methionine synthase domain 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320334538|ref|YP_004171249.1|
Sequence length 1212
Comment methionine synthase [Deinococcus maricopensis DSM 21211]
Sequence
MTQRNDRTQELLSIARERILILDGGWGTMLQRRGLTEADYRRAEFAWDVQYKGNHDVLQL
TRPDVIREIHRLYFEAGADITSTNTFSSTSIAQADYGLAHLARALNVAGARLAREVADEL
TAQDGKPRFVAGSVGPTNRTATLSPDVERPEFRAVTFDDLAAAYEEAVEGLLEGGADLIL
IETVFDTLNAKAALFACEAVFERLGRRAPVMLSGTITDASGRTLSGQTPEAFTVSTEHAP
LFSLGLNCALGADLLRPHLRALARSTDVLVSVHPNAGLPNAFGEYDETPEHTAGVLREFA
EDGLVNIVGGCCGTTPEHIRAIAKAVRDVKPRVAAPLPRQLRLSGLEAFTVTPEVNFVNV
GERTNVTGSPKFSRAILEGDFDAGLKIARQQVVSGAQVIDINFDEGLLDGEAAMVRFLNL
LAGEPDIARVPIMLDSSRWSVLEAGLKRIQGKGIVNSLSLKEGEAAFLAQARTIRRYGAA
VVVMAFDEQGQADTLERRTEICARAYRLLTQQAGFAGHDIIFDPNVLTVATGLPEHDRYA
LDFIEATRWIKANLPGALVSGGISNVSFSFRGNNAVREAMHAVFLYHAIRAGLDMGIVNA
GMLAVYDDLDPELREHVEDVILARRADATERLIELAERFKGEKRSASSNAASWRDLPVRE
RLSHALVQGISDFVEVDAEEAYQLLGSPLAVIEGPLMDGMNVVGDLFGAGKMFLPQVVKS
ARVMKRAVAHLTPYLEAEKASGSSKGRVVMATVKGDVHDIGKNIVGVVLACNGFEVTDLG
VMVSGERILDEAARLNADVIGLSGLITPSLDEMVNVAREMERRGLNTPVLIGGATTSRAH
TAVRIAPAYSGPVAHVLDASRAVTVVQDLLGDPDGFKVRADAEHERQRARHADRTVRLTP
LDAARANALKLTAPAQPSPREPGRQVIEQPLGELRAFIDWTPFFIAWELPGVYPKILDDP
RVGAEARQLLADANALLDRAEREGLLTAQGVIRLAPATRDGDDILLADGTVLHTIRQQRE
QQGPNVALSDFVADGGDHVGLFAVTIHGAEALAVQFEEAHDDYNAILTKAVADRLAEAFA
EKLHRDVRTRHWGYAADEQLDHAALIREKYVGIRPAPGYPAQPDHTEKRTIFAQLRAEEI
GLTLTDSCAMLPAASVSGLYFAHPQSAYFAVGRIGEDQVRDYARRKGWTQAEAERWLAPI
LAYTPALTGGVR
Download sequence
Identical sequences E8U945
gi|320334538|ref|YP_004171249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]