SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320335275|ref|YP_004171986.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320335275|ref|YP_004171986.1|
Domain Number 1 Region: 3-379
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 4.97e-123
Family ArgJ-like 0.000000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320335275|ref|YP_004171986.1|
Sequence length 382
Comment arginine biosynthesis bifunctional protein ArgJ [Deinococcus maricopensis DSM 21211]
Sequence
MKFPSGFRAAARAAGIKPSGKPDLSCVVSDHDCAWAFAGTRSTTAAACVERNRARYADTQ
PIRALLVNAGNANAATGAQGARDNAALADALGDILHVPAGSVLTASTGIIGHLLPMPRVL
SGLEHLPDELSDDVDAFANAIMTTDTHPKTAEVTLSTGARIVGCAKGSGMIHPDMATMFA
FAFTDARVDQGALRAAFPAIVARTFNAVTVDGDTSTNDMAVVLAGGAAGDVDTAEFLTAL
EGVMRTLARMIAADGEGATKLLTVRVTGARTEAEALTAARTCCVSPLLKSAVHGNDPNWG
RVIMAVGRSGAGVDIERLSVHVQGVPVFRGGPLAYDAASVSASMRAEEVVFDVDLGVGDA
RGEAWGCDLSAEYVSINADYTT
Download sequence
Identical sequences E8UB82
gi|320335275|ref|YP_004171986.1| WP_013557825.1.15749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]