SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320335774|ref|YP_004172485.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320335774|ref|YP_004172485.1|
Domain Number 1 Region: 47-330,478-595
Classification Level Classification E-value
Superfamily Subtilisin-like 4.45e-72
Family Subtilases 0.00011
Further Details:      
 
Domain Number 2 Region: 343-473
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000131
Family PA domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320335774|ref|YP_004172485.1|
Sequence length 867
Comment Lactocepin [Deinococcus maricopensis DSM 21211]
Sequence
MKNLKIKATGLLTLAIALTACSQNTTPAPNASAPIGGIDVGTAGIHNAWIVELEGDPTAL
NAQSVRTQHAQFKQQLAQSGLRVQTTHEYNTLFNGFAIKASDTEVRRLSRLPGVLNVYPD
VRVDLPKDTVGEVPSEPEMFSAVTMTGADIAQNEYGLTGKGVKVAIMDTGIDIDHPAFAG
RIIKQHDFVGDDFNGTTKTQRVEDEIADDCAGHGTHVAGIVGGNDPATGFKGVAPGVFFG
SYRVFGCAGSTSSSIMIEAMERAYKDGMQVLNMSIGASFQWPDYPTGKVASRLVKQGMVV
TVSAGNSGDKGQFASGAPSLGENVIAVANVANLKATVNAFKLQDGSSVYYDGKTGSPADV
PVAGTVEVVAVTPTQGCKTANGTNPFAAGSLTGKVALISRGTCTFYEKALNAQQAGASAV
IIYNNRAGYIGGMALTGTTPIDIPVIGIQQADGQKIAAMPQPVMMTWTNETSLVPNVGGG
GTAASSSLGSSPDLELKPDVAAPGNNIYSTYPLSKTAGGYAVLSGTSMAAPHVAGAAALL
LEANPKIASKDMRALFQNTANLRYFYTAAGQPTTALDYVQKQGAGMIDIVSAYNATVSAT
PSKLSLGESEGMTTKSKVVVLRNNGLRDATYSVTHNAALTLAGTTLAPTPNMGAATVNVN
GHPLTSTQGIDITVPAGGQLDLNIEITADASIPDLAQYGGYIVLKSQRVNSIVIPYSGFQ
GDYQKLVVLKDAMINGQTLPFPLLFKDGDVADENTTYTLQNGDEPSVGVHFAHQSRRLMV
TVVNASGQQVANLQTSEYWGRNADDNWTSNDSDVWDTFTWDGTLDDGQKAPDGTYRVKVR
VLKALGDAENPAHYEEDFSPAFNIKRN
Download sequence
Identical sequences E8U4F5
gi|320335774|ref|YP_004172485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]