SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320335823|ref|YP_004172534.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320335823|ref|YP_004172534.1|
Domain Number 1 Region: 25-126
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.13e-22
Family Siroheme synthase N-terminal domain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 134-182
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.00000000706
Family Siroheme synthase middle domains-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320335823|ref|YP_004172534.1|
Sequence length 215
Comment siroheme synthase [Deinococcus maricopensis DSM 21211]
Sequence
MLARVSDRSVGDVAPSSAPYTDRVKLYPAFLDLRGERVLVVGGGPVAHRRARALLDAGAH
VSVVAPDVLPDLAGLPVQVERRAFRPADVAGARLVFACTDRDDVNDAVAAAARDAGILVN
HAGRAEGGSVRLGATLTRGPVTVAVNTGGELPMLAQALRDHLNAALPEHLPVDDWTAARE
RALTHPEPERTHALNALRARIHAALQAARPSEAHA
Download sequence
Identical sequences E8U4K4
gi|320335823|ref|YP_004172534.1| WP_013558372.1.15749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]