SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320334878|ref|YP_004171589.1| from Deinococcus maricopensis DSM 21211

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320334878|ref|YP_004171589.1|
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.59e-17
Family Prokaryotic phospholipase A2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320334878|ref|YP_004171589.1|
Sequence length 224
Comment phospholipase A2 [Deinococcus maricopensis DSM 21211]
Sequence
MRNAPLFGLLLGTLVLASCNQTASTPTAADPAPTSATSTIQNDLNAFKQLQVQVSRGEMP
APVDSDGNPVDLQKLIGQIEDDLAHPLAAPTNEVISAQAAYAQRIYTDIAADNNFTGNLA
YNKRTFPRFNWGNDGCSIPGLPDAASKYIVFHPACVQHDFGYRNARAYPNLMNENHRGWV
DGQFKEHMRTICSKRNILLRPGCYADAEIFWAAVRHGGRGSFYN
Download sequence
Identical sequences E8UA35
WP_013557429.1.15749 gi|320334878|ref|YP_004171589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]