SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325279000|ref|YP_004251542.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325279000|ref|YP_004251542.1|
Domain Number 1 Region: 294-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.33e-35
Family ABC transporter ATPase domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 23-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.27e-22
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 751-825
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000222
Family Smr domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325279000|ref|YP_004251542.1|
Sequence length 827
Comment MutS2 protein [Odoribacter splanchnicus DSM 220712]
Sequence
MVYPENFESKIKFDKIRQFVQKNCLSDMGRDLVEAMKFSTEPTEIRERLEETQEFMSILE
EEDQFPGDHFSDARPFLNKVRVEGLFLEVAEMVALKQSLESLTAIVRFFHGKDERYPRLT
AQAGDIQLFPYILQRLDSIVSRHGSIKDTASPELGDIRHRLQRKQNGISRRMQALLQQAQ
TEGWAEKDTSIAIRDGRMVIPVPSAYKRKINGIVHDESATGKTSYIEPAEIVETNNEIRE
LELEEKREITRILRRFAEDLRPYVDDLIPAYDFLAYIDFVRAKAAFSLYIEATVPAFSER
PEMFWYSARHPLLWLSLKNSDKNIVPLKIEIDETQRIILISGPNAGGKSVCLQTAGLLQY
MFQCGLPVPVSEASRFGIFKKILIDMGDEQSIENDLSTYSSHLINMKNFLRYGDENTLIL
IDEFGTGTEPMLGGAIAEAILKTLNQKQVKGVITTHYTNLKHFAAETTGIENGAMLYDSH
RMLPLFELCIGKPGSSFAFEIAKKIGLPKEILEDAASKIGEDHINYDKHLKDIARDKRYW
EEKRRRIHENEKRLDEVVEKYRQELTEASRLRKEIIKEAQQKAQEIIHSANKTIEQTIRD
IRENQAEKEKTKEIRQKMEAEKERLLSEQASAEEERIRKKMEKLQNREKNKKTKNKASAS
TPASEGTTTELPLQKGDFVSLPNKAIGEILEINDKTAVIALGNLRTTAKLSQLKRASASQ
AKKVARTQPQASYANIRENISQKRFDFKPDIDLRGMRGEEALQKVITFLDEAVMLNYKEV
RLLHGTGTGALRQLIRQYLSTNPLVASFGDEQIQLGGAGITVVKLDI
Download sequence
Identical sequences A0A1Q6IJ17 A0A1Y3XXB3 F9Z458
gi|325279000|ref|YP_004251542.1| WP_013610606.1.15203 WP_013610606.1.23918 WP_013610606.1.9270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]