SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325279307|ref|YP_004251849.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325279307|ref|YP_004251849.1|
Domain Number 1 Region: 382-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-28
Family ABC transporter ATPase domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 125-373
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000000301
Family DNA repair protein MutS, domain III 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325279307|ref|YP_004251849.1|
Sequence length 595
Comment DNA mismatch repair protein MutS domain-containing protein [Odoribacter splanchnicus DSM 220712]
Sequence
MKPDEYYQKQIDHYTARLKQIKKRRNLITLAKLLTFGYMIFLIYLLINHSTQPLLLLGIG
AILVFIFLTLWDSQIIYRQHLIEELLRINTLESDYLAGNFSALDQGERFNDPAHPYAHDL
DLFGEDSLFQHLNRTVTFSGTQKLVSWLLSLSKDPEVIHSRQQAAEELCAEPEWCQHFRA
AGALHPTQALDAVILKSGPTESPFFSKHSTVRLILWIANTIVIVSWAVTSFTPLPFSISL
VLSLLQLSALALYIKKINAYHQRLNLFLKTISNYLPLVRLIHDQSFRSPYLQKIRHSLFT
PESNSLQALTQLHRIQNNLDQRGNIVIAFILNGLYLKDFHTLLRLDHWRKKYGPDIETWT
DVLSEADALISMANYRFNHPAYCLPVICQDRLLDTEEIGHPLLKSERNVTNDFSIRSLHQ
IAIVTGANMAGKSTFLRTIGVNLILAQSGNVVCSRYFAFQPMTLFTSMRTTDSLSKDTSY
FHAELLRLQQLVNIAQQEDKVFIILDEMLKGTNSVDKLNGSLAFLKRILSYPISGLVATH
DLALGELADDFPEHFFNVCFEIVHSGSQITYDYKLHPGISSNMNASILLKQMGLI
Download sequence
Identical sequences F9Z6N2
WP_013610911.1.15203 gi|325279307|ref|YP_004251849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]