SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325279433|ref|YP_004251975.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325279433|ref|YP_004251975.1|
Domain Number 1 Region: 60-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.23e-22
Family Ribosomal protein L9 C-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.49e-17
Family Ribosomal protein L9 N-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325279433|ref|YP_004251975.1|
Sequence length 146
Comment 50S ribosomal protein L9 [Odoribacter splanchnicus DSM 220712]
Sequence
MQIILLTDIANLGHKDDVINVKPGYGRNYLIPQGYAILATEAAKKIVAENTKQRAHKEAK
LKAEAEELAAKLAELKLTVGAKTSSTGKIFGSVNNIMISEALLAQGFDIDRKKIMLKEIK
EVGTYTAVIKLHREVKVDVQFEVVSE
Download sequence
Identical sequences A0A1Q6IKI4 A0A1Y3YHB6 F9Z7U1 R6FFQ3
gi|325279433|ref|YP_004251975.1| WP_013611037.1.15203 WP_013611037.1.23918 WP_013611037.1.9270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]