SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325279621|ref|YP_004252163.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325279621|ref|YP_004252163.1|
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.73e-23
Family Crotonase-like 0.049
Further Details:      
 
Domain Number 2 Region: 407-464
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000772
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325279621|ref|YP_004252163.1|
Sequence length 467
Comment peptidase S49 [Odoribacter splanchnicus DSM 220712]
Sequence
MSGIYTFRKLVLLVLGICWLNTLGAAEPEKVVYKVDIKDEIGPEVWRLARKSFDLAGQEK
ADYILIHMNTYGGMVVYADSLRSMILNSRKPVWVFIDNNAASAGALISIACDKIYMREGA
NIGAATVVNQTGEAMPDKYQSYMRSMIRSTAEAQGRDTLVQGRDTVYRWKRNPHIAEAMV
DQSIYIQGITDSGRVVTFTAREAMKYGFCDGMAESVEEVLKKEQVENYTIRSYHPTVTDR
IIGFLINPVIQGLLIMVIVGGIYFELQTPGIGFPLAAALTACLLYFAPLYLEGFAGYWEI
IAFVVGVVLLLLEIFVIPGFGVAGISGIVLIIVALVFAGIDHFSFRFLGDFVRPLVRSLF
LVVSASLVSLLMSMWLGAKLFGSRRWAFALHAEQKPEDGYVGVDLSVREEIGKQGIAVTD
LRPAGKVEVGGEVYDAVSLLGDYIEKGNRVMIKKYQAGQVYVVKCEK
Download sequence
Identical sequences F9Z948
gi|325279621|ref|YP_004252163.1| WP_013611205.1.15203 WP_013611205.1.23918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]