SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325281175|ref|YP_004253717.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325281175|ref|YP_004253717.1|
Domain Number - Region: 139-236
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0811
Family DNA repair protein MutS, domain III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325281175|ref|YP_004253717.1|
Sequence length 292
Comment hypothetical protein Odosp_2554 [Odoribacter splanchnicus DSM 220712]
Sequence
MVKSMTGFGKITIENGNRKVVIEIKSLNSKTLDLNLKMPNLYKEKEMEIRNIVKEQLDRG
KVEMCIYFDNTESDKDVTINKPVVTQYFNQLLDIANELGIEADKNKILQTVMRFPDTLQI
KSEELEDTEWEALEAGIKKALEEINKFRIQEGKALIKDICHRIELIQELSAQVPQFEVKR
VEVIRQKLQEKINEWTDIQNIDENRLEQEIIYYLEKLDITEEKVRLANHCKYFLETIEHE
DAPGRKIGFIAQEIGREINTMGSKANDHDIQKLVVKMKDELEKIKEQSLNVL
Download sequence
Identical sequences A0A1Y3Y1Y0 F9Z388 R6G3R0
WP_013612730.1.15203 WP_013612730.1.23918 WP_013612730.1.9270 gi|325281175|ref|YP_004253717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]