SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325281277|ref|YP_004253819.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325281277|ref|YP_004253819.1|
Domain Number 1 Region: 27-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325281277|ref|YP_004253819.1|
Sequence length 52
Comment hypothetical protein Odosp_2661 [Odoribacter splanchnicus DSM 220712]
Sequence
MILWTIALLAISIMTTSSVNPGYDEFGNDINECLEDPCPEGYTCMNLPGSFL
Download sequence
Identical sequences F9Z413 R6FZZ9
gi|325281277|ref|YP_004253819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]