SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325281693|ref|YP_004254235.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325281693|ref|YP_004254235.1|
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00245
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325281693|ref|YP_004254235.1|
Sequence length 76
Comment hypothetical protein Odosp_3092 [Odoribacter splanchnicus DSM 220712]
Sequence
MKTALKKSFVLIGIALFFVLMAWAEQKIWAWDKNVPEEEYCISGYFEKNGENATTVYGYC
VCFQGFWGPQCQFIAE
Download sequence
Identical sequences A0A1Q6IM15 F9Z7N9
gi|325281693|ref|YP_004254235.1| WP_013613246.1.15203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]