SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325281772|ref|YP_004254314.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325281772|ref|YP_004254314.1|
Domain Number 1 Region: 227-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-28
Family ABC transporter ATPase domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 23-222
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000916
Family DNA repair protein MutS, domain III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325281772|ref|YP_004254314.1|
Sequence length 472
Comment DNA mismatch repair protein MutS domain-containing protein [Odoribacter splanchnicus DSM 220712]
Sequence
MILREAIRQVRGFRYMIEQLDICSAVGRRVLYDLPWLDSKSRLEAEFERIQKIMVLFEQP
ENESRLERLTGKLMQVRDIRGTIGRMAMEQVLDDLELFELKTFALCSEEIRGLVEEWRIV
LLPELEPVVRLLDPEGNRIPHFYIYDTYSAELARLRAEIKQKSLQGAEERELEALYVQSV
VLEDKVREELSVQLRPYHDDLKQALEAVGLLDVVLAKARQAIRGQLTLPQIPEEGEMVFE
GLFHPQIREILEQEGRAFQAVDLKLEKGTTVITGANMAGKTVLLKSVQLAQYLMQFGFYV
PARRAGMPLVEQVLTSIGDDQDELNGLSSYAAEMLRVDEMIRQVRQRSKILVLIDELART
TNPVEGRAIVNGVVDFLTTHRVMAMVTTHYSGITAECRKLRVRGFVENRIEGNMTLKNIN
EFIDYSLEEDSGEEVPQEAMRIAWMLGIDRGVLERVENYLQEENPDWKKTVQ
Download sequence
Identical sequences F9Z8C1
WP_013613322.1.15203 gi|325281772|ref|YP_004254314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]