SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325281290|ref|YP_004253832.1| from Odoribacter splanchnicus DSM 20712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325281290|ref|YP_004253832.1|
Domain Number 1 Region: 269-567
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.19e-82
Family DNA repair protein MutS, domain III 0.00000186
Further Details:      
 
Domain Number 2 Region: 568-804
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.93e-57
Family ABC transporter ATPase domain-like 0.00000161
Further Details:      
 
Domain Number 3 Region: 7-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.22e-37
Family DNA repair protein MutS, domain I 0.0000401
Further Details:      
 
Domain Number 4 Region: 118-268
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 5.23e-34
Family DNA repair protein MutS, domain II 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325281290|ref|YP_004253832.1|
Sequence length 871
Comment DNA mismatch repair protein mutS [Odoribacter splanchnicus DSM 220712]
Sequence
MAKKEGNETPLMQQYYATKAKYPDAILLYRMGDFYETFGADAITTSRILGITLTKRSSGS
PGTVELAGFPYHAIDTYLPKLVRAGQRVAICEQLEDPKKTKFLVKRGVIELVTPGACYSE
YSTDTKSNIFLASVYFNKTEAGLSLLDLSTGEFLTTEGSHATIDKLLNSFQPKEVIYPRG
QEARFHELFGNKFYIYPIEEWFFDRDAASERLEKHFEVNSLKGFGIEHMNCGISSAGAIL
NYLEMTKHDMISHITSISRIDESHCVLLDKFTLRNLELLHSAYEEGRSLVDIIDRTITPM
GGRTLRRWICMPLKSPEEINQRLDIVDHFIRQEDRRLQAENFLESIGDLERLASKIGVGR
ITPREMNQLKIALSCIAPLKDLCQQSESAVMKKMTEPLNPCTELFEKIKFQLQENAPHQV
NKGGVIATGVNAELDELRNISSNGKELLLQMQQREIEATGIPSLKIGFNNVFGYYIEVTK
AHKDKAPANWIRKQTLVNGERYITPELKEYEDKILGAEDRILAIETELYNNLLQEAAGYI
RPLQEDAKIISALDVLISFAEISIANNYHRPEINDSDVLDIKAGRHPVIEKQLPPGEEYI
SNDVLLDNKKQQIIIITGPNMAGKSALLRQTALIVIMAQAGCFVPAASAKIGYVDKIFTR
VGASDNISQGESTFMVEMNEAANILNNISDRSLVLFDELGRGTSTYDGISIAWAIVEYLH
EHPKYHAKTLFATHYHELNEMEHSFKKIKNYNVSVKEVAHKVIFLRKLVKGGSNHSFGIQ
VGKMAGLPQSVIKRADEILKQLENDRDKNGTIQKNVESIASAREGLQLSFFQLDDPVLSQ
IRDEIAGLDINGLTPLEALNKLSEIKKIILG
Download sequence
Identical sequences F9Z426
WP_013612845.1.15203 gi|325281290|ref|YP_004253832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]