SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530779971|ref|YP_008431772.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530779971|ref|YP_008431772.1|
Domain Number 1 Region: 2-275
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 2.09e-48
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530779971|ref|YP_008431772.1|
Sequence length 286
Comment hypothetical protein N186_01855 [Thermofilum sp. 1910b]
Sequence
MDDAEILETIRTAARRAAAEALKVLEEGTGAKEQGRGSGGDISLLGDLVAEQTAISYLQE
KIGSFRVVSEEIGEKTFGDGGSYTFIIDPLDGSRNYKRGAPLFAVSIAVARGETLENVFG
GVVYAPLLSLEFYALRDRGAYLNGKKIEAKTSSDGLESKVIAVSSPPKASFLPSIFVSRL
ATHGVALRMLGSASLELAMLASGSIDAYIDAWGTMRIVDMAAAQLIAREAGAYTLIGGKD
GNPPLLSLKERVYILVAASRDLAESIASLYRESFGYDIQDVFKVMK
Download sequence
Identical sequences S5ZJS6
gi|530779971|ref|YP_008431772.1| WP_020962066.1.19067 WP_020962066.1.66495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]