SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530780324|ref|YP_008432130.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780324|ref|YP_008432130.1|
Domain Number 1 Region: 14-277
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.7e-45
Family ROO N-terminal domain-like 0.00000889
Further Details:      
 
Domain Number 2 Region: 254-400
Classification Level Classification E-value
Superfamily Flavoproteins 3.05e-22
Family Flavodoxin-related 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530780324|ref|YP_008432130.1|
Sequence length 402
Comment hypothetical protein N186_03790 [Thermofilum sp. 1910b]
Sequence
MHASRPIIREVVRDLYVLRIDDHETKFFEGLWEIPEGISYNAYLLKTGEGAVLFDGWKKT
YADLLVEEIEKLVDLRDIKYVVVHHMEPDHSGSIPALMARATNAVLLGHPLAGKMISNFY
GAYKFKPVSDGEELKIGEHSLRFIHAPWLHWPETIFTHIVNLNVLLTCDAFGSYSLPPVF
DSEVEDWNQLDVAIRKYYVNVIGKYSQNVLKALEKLKSLQVSPSIIAPSHGAIFRDKPAH
ILDKYIEIAQGVPKENKAVVAYVSMYGFVEQMIDAAVSLLREKGFNVKIYRFTDNHRDNV
SDLLGDLSDAGLMVIGGGTYEAGVQPLLGYILHLIASKLGYRAGNLPVLVLTSYGWGPVA
GKMVLEELKNKGFTRIENVEATGQVRREHVEKIRQAIEKLTS
Download sequence
Identical sequences S5ZVG4
WP_020962424.1.19067 WP_020962424.1.66495 gi|530780324|ref|YP_008432130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]