SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530780656|ref|YP_008432464.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780656|ref|YP_008432464.1|
Domain Number 1 Region: 91-207
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.00000000000122
Family V-type ATPase subunit E 0.005
Further Details:      
 
Weak hits

Sequence:  gi|530780656|ref|YP_008432464.1|
Domain Number - Region: 18-55
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0183
Family F1F0 ATP synthase subunit B, membrane domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530780656|ref|YP_008432464.1|
Sequence length 210
Comment hypothetical protein N186_05535 [Thermofilum sp. 1910b]
Sequence
MGEHKSLLEVIIKEMRSAAEEEAQKILKEAEAEAQKILEDARAKAESLRKEKLNQLVFEY
RQKLLSEIAPMRLELKRKYIQEKYRLVENQVDELIMEVVNEITGSSDTRKAFLVKVLSDA
VASMASSDLVINPCYGSKDIIPDVLEEVKQKLLSLKPNLRIEVSTPIECREGAVITSSDG
REIYNATLEAKIKEVRESVLPKIMEQLSKK
Download sequence
Identical sequences S5ZLF0
WP_020962758.1.19067 WP_020962758.1.66495 gi|530780656|ref|YP_008432464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]