SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530780666|ref|YP_008432474.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|530780666|ref|YP_008432474.1|
Domain Number - Region: 57-137
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0179
Family Tetracyclin repressor-like, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530780666|ref|YP_008432474.1|
Sequence length 143
Comment transcriptional regulator [Thermofilum sp. 1910b]
Sequence
MEVPLKPLGKEDTRKLELALIFGTLMRQDVLEKIRNAEDKITWLDSLIIASGALARERAG
MPVTKIAEELGRTEATIRNHLTGKTEAGKIVKETYELLVKKGGKLEFLIPGGEEIEKLRR
ENEELKKKIENVKQALQSLLSTL
Download sequence
Identical sequences S5ZLG0
gi|530780666|ref|YP_008432474.1| WP_020962768.1.19067 WP_020962768.1.66495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]