SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530780687|ref|YP_008432495.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780687|ref|YP_008432495.1|
Domain Number 1 Region: 53-186
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.7e-37
Family Band 7/SPFH domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530780687|ref|YP_008432495.1|
Sequence length 290
Comment hypothetical protein N186_05705 [Thermofilum sp. 1910b]
Sequence
MDPVTLILLFVLLFVFVWIIASYIRIVPEYQRLVVLRLGRVVRIAGPGLVFLVPFIEQGI
TVDLREQYIEVTKQTCITRDNAPVDIDFLIYFKVIDPKRSVVEVSDFRGAAVGIATTTLR
AVVGDIELDQVLAKREYINEVLREKLDEVTARWGVKVTAVEIREILPPREVQDAMIKQMS
AERNRRAMVTEAEGKREAAIKVAQGEKEAMILKAEGEKQAAILRAEGAALALKYLDDQAK
LIDEKTLMLQYFTTLKDIASSPSTKFVLPLELFKFLKPFEEMIEKRTTKE
Download sequence
Identical sequences S6A5Q4
WP_020962789.1.19067 gi|530780687|ref|YP_008432495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]