SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530780713|ref|YP_008432521.1| from Thermofilum sp. 1910b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530780713|ref|YP_008432521.1|
Domain Number 1 Region: 6-220
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 5.37e-45
Family Triosephosphate isomerase (TIM) 0.0000000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530780713|ref|YP_008432521.1|
Sequence length 229
Comment triosephosphate isomerase [Thermofilum sp. 1910b]
Sequence
MAATKIEYPLILINFKAYAEASGKKGLQLAKVAEKLSKEYGVTIAVAPQLTDLMFIAQQV
DIPVFSQHVDDVSPGSHTGHVTLEAVKDAGAIGTMVNHSERRVRADQIDVVVKRARQLNL
VTVVCTNTPEVTAAMAALGPDMVAIEPPELIGTGIPVSKAKPEVVTSSVDLVKKINPNVK
VLCGAGITTGDDVAAALRLGTVGVLLASGVVKAKDWEKAILDLIRPILK
Download sequence
Identical sequences S5ZEH7
gi|530780713|ref|YP_008432521.1| WP_020962815.1.19067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]